(data stored in ACNUC30630 zone)

EMBL: FP565814.LPLA

FP565814.LPLA        Location/Qualifiers
FT   CDS             complement(371690..372826)
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="SRM_00313"
FT                   /product="Lipoate-protein ligase A"
FT                   /function="Catalyzes both the ATP-dependent activation of
FT                   exogenously supplied lipoate to lipoyl-AMP and the transfer
FT                   of the activated lipoyl on the lipoate-dependent enzymes.
FT                   Creates an amide linkage that joins the free carboxyl group
FT                   of lipoic acid to the epsilon-amino group of a specific
FT                   lysine residue in lipoyl domain of apoproteins"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00313"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23234"
FT                   /db_xref="GOA:D5H5C9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C9"
FT                   /protein_id="CBH23234.1"
FT                   /translation="MLPGPLLGGSRIRSCPSPMSSSLPAPELSAPDAPPPSPDDARAAP
FT                   LVLIDNEGVTDPTLNLALEEWTLRNLDPQYRYLLFYVNEPSIIIGRNQNTLEEINRAYV
FT                   EDRNVRVVRRMSGGGAVYHDEGNLNFSFMTDYKPGRLHNFNRFTRPLRRVLASMGVEAE
FT                   LEGRNDLVAGDGRKISGNAQFSTPRRMFSHGTLMFNTDRKALARALDVTPDKIDSKAHQ
FT                   SVRKRVANISEVGGRVYDVPTFRRLLVDGLFPQDETPVYTLRSDEWDAVEDLAERRYRR
FT                   WAWNVGASPPFDVRRRERFEEGEVDVRLGIEDGKIDRIQIYGDFLGTWGTTAPLEHHLR
FT                   GTPYAPEALRTKLAGVDVSPLLGGLANDDFLALLYEEG"
     MLPGPLLGGS RIRSCPSPMS SSLPAPELSA PDAPPPSPDD ARAAPLVLID NEGVTDPTLN        60
     LALEEWTLRN LDPQYRYLLF YVNEPSIIIG RNQNTLEEIN RAYVEDRNVR VVRRMSGGGA       120
     VYHDEGNLNF SFMTDYKPGR LHNFNRFTRP LRRVLASMGV EAELEGRNDL VAGDGRKISG       180
     NAQFSTPRRM FSHGTLMFNT DRKALARALD VTPDKIDSKA HQSVRKRVAN ISEVGGRVYD       240
     VPTFRRLLVD GLFPQDETPV YTLRSDEWDA VEDLAERRYR RWAWNVGASP PFDVRRRERF       300
     EEGEVDVRLG IEDGKIDRIQ IYGDFLGTWG TTAPLEHHLR GTPYAPEALR TKLAGVDVSP       360
     LLGGLANDDF LALLYEEG                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page