(data stored in ACNUC30630 zone)

EMBL: FP565814.LSPA

FP565814.LSPA        Location/Qualifiers
FT   CDS             587438..588175
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="SRM_00482"
FT                   /product="lipoprotein signal peptidase"
FT                   /function="# This protein specifically catalyzes the
FT                   removal of signal peptides from prolipoproteins."
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00482"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23403"
FT                   /db_xref="GOA:D5H5U8"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U8"
FT                   /protein_id="CBH23403.1"
FT                   /translation="MRVFWIAGAVVLLDQATKATVLQFMYREQSIPLLGDWLRLTFTEN
FT                   PGMAFGITIGPPGTVTVLSLLATMLVGAYIYQVRNDYAPYRWSLAFILGGALGNIIDRV
FT                   FYGVLLDYGPYFTGRVVDFIHVSLWQGFIPRIIPVFGGAYMELFPIWNVADMSIVVGVV
FT                   GVMVFHQAFHERRIAKRRAARADGRTWRRPAAVFSDLDLEAPPPAPSALTQPDAPASRG
FT                   EAASGSGAASASARSSAVSEPHP"
     MRVFWIAGAV VLLDQATKAT VLQFMYREQS IPLLGDWLRL TFTENPGMAF GITIGPPGTV        60
     TVLSLLATML VGAYIYQVRN DYAPYRWSLA FILGGALGNI IDRVFYGVLL DYGPYFTGRV       120
     VDFIHVSLWQ GFIPRIIPVF GGAYMELFPI WNVADMSIVV GVVGVMVFHQ AFHERRIAKR       180
     RAARADGRTW RRPAAVFSDL DLEAPPPAPS ALTQPDAPAS RGEAASGSGA ASASARSSAV       240
     SEPHP                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page