(data stored in ACNUC30630 zone)

EMBL: FP565814.MVIM

FP565814.MVIM        Location/Qualifiers
FT   CDS             complement(509988..511109)
FT                   /transl_table=11
FT                   /gene="mviM"
FT                   /locus_tag="SRM_00426"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00426"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23347"
FT                   /db_xref="GOA:D5H5P2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P2"
FT                   /protein_id="CBH23347.1"
FT                   /translation="MGERRRTRDWKRAARTLAHATHLPARRWPLNLQFPTVQSSPPSAN
FT                   NMAVNWGILGTGNIAHLVAEDLRRLPNAELTAVGSRAQARADTFGDTFDVPHRHGSYEA
FT                   LVADPALDVVHVATPHSAHLEHATLALEAGHAVLCEKPLALNAAQAERLIDTARRHDQF
FT                   LMEAMWTRFLPVMDDVHRLVHEERVLGDVHLLRADIGVTQPVDPTHRLFDPALGGGALL
FT                   DLGVYPVAFAFDLFGAPDTVTSSAVLADTGVDAQCAAVFRYDDGTQAMWHASLGADAGR
FT                   TCVLAGPEGRLRGTRAWWKGAPFELTRSDGATASWARPYEGNGYQFEAAHVMACLREGR
FT                   TESPVMPLDESHALLRTMDALRAEWGVAYPQEA"
     MGERRRTRDW KRAARTLAHA THLPARRWPL NLQFPTVQSS PPSANNMAVN WGILGTGNIA        60
     HLVAEDLRRL PNAELTAVGS RAQARADTFG DTFDVPHRHG SYEALVADPA LDVVHVATPH       120
     SAHLEHATLA LEAGHAVLCE KPLALNAAQA ERLIDTARRH DQFLMEAMWT RFLPVMDDVH       180
     RLVHEERVLG DVHLLRADIG VTQPVDPTHR LFDPALGGGA LLDLGVYPVA FAFDLFGAPD       240
     TVTSSAVLAD TGVDAQCAAV FRYDDGTQAM WHASLGADAG RTCVLAGPEG RLRGTRAWWK       300
     GAPFELTRSD GATASWARPY EGNGYQFEAA HVMACLREGR TESPVMPLDE SHALLRTMDA       360
     LRAEWGVAYP QEA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page