(data stored in ACNUC30630 zone)

EMBL: FP565814.NUOI

FP565814.NUOI        Location/Qualifiers
FT   CDS             712083..712802
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="SRM_00578"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /function="May donate electrons to ubiquinone."
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00578"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23499"
FT                   /db_xref="GOA:D5H644"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5H644"
FT                   /protein_id="CBH23499.1"
FT                   /translation="MPGTPENTKKENERDLNFWESLYLPELFKGLGYSFDRMANEPTYT
FT                   FEYPEEQWYPPDSYRGRPVLVEEDDRPRCVSCNLCARACPPLAISMQSKEVNNVKEREP
FT                   EWFEINMLRCIYCGFCEEVCPEEAIVMSKEHDLTFQSRDEAVFDLDDLLRPSEQMQDRL
FT                   EYLDQYKNKQFGQQWDFKKENNLHSVKDQHFLDWLAEEGMDDLDTTHQRDDRMATEGDQ
FT                   DWGGDRQGPPQTTHAAE"
     MPGTPENTKK ENERDLNFWE SLYLPELFKG LGYSFDRMAN EPTYTFEYPE EQWYPPDSYR        60
     GRPVLVEEDD RPRCVSCNLC ARACPPLAIS MQSKEVNNVK EREPEWFEIN MLRCIYCGFC       120
     EEVCPEEAIV MSKEHDLTFQ SRDEAVFDLD DLLRPSEQMQ DRLEYLDQYK NKQFGQQWDF       180
     KKENNLHSVK DQHFLDWLAE EGMDDLDTTH QRDDRMATEG DQDWGGDRQG PPQTTHAAE        239
//

If you have problems or comments...

PBIL Back to PBIL home page