(data stored in ACNUC30630 zone)

EMBL: FP565814.PE101

FP565814.PE101       Location/Qualifiers
FT   CDS             complement(121373..124693)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00101"
FT                   /product="sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23022"
FT                   /db_xref="GOA:D5H4R7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R7"
FT                   /protein_id="CBH23022.1"
FT                   /translation="MESDEPFSAPFSRSSFSEPAGWGPDTNAPAAVYADPGADVDPERS
FT                   FGRVLDLATRLFEAPMGIGTLHANGQPRVVAADGLRDAGLQDEGDGIKARLCTRTLRSP
FT                   GATVVTNATDDDRLADHPWVAGDPGIRFYAGTPLVGPQGHRIGSLCVLDTEAQSPPPAD
FT                   VDRLEGLAEMIVNELELHRQADAWDRARQQYEAIFNHTYQFTGLLTPDGILVEANDTAL
FT                   EFGGLEREEVVGTPFWDTHWWQTGPETQQKLRAAVEQAAEGEFVQYEADVQGADETRTI
FT                   DFSIRPVTDGDGSVTMLIPEGRDITDRKRQERQLRKEKQKTEEALQARDALLGSITENI
FT                   SEGIYRSTPDDGLVYANEALADMLRHRSVDALLEADPVHFYADPDQRAQVIQQSNRNDG
FT                   ITGVEVEFRRTDGTTFTGLLSATTVRGPDGAVQYYDGAVTEITEQKRQEQQLRRSRERW
FT                   RRLVEKLEDGLHISVDGEIRYINPAGAAIVGAETPEDIVGRSLQEFVVSERTQQDVVED
FT                   RLRTVYQERASTPPRELEIIGLDGARRVIESYTVPIEFDGEQAGQTVFRDITEQKEMEQ
FT                   ALREREARLRSITENVSDGIYRSTPNEGLVYANRAFADIFGYESVEAILQIDPIELYAN
FT                   PDARSENRRITKEQDHIDAAEAEFRRKDGSTFTGLVSATTVRDENGEVLYYDGAITDIT
FT                   EQKEQARTLRDRQQKLESLYTATRHLLRAETPDAVATRIQDVLQDVFDYPLAGVDFAED
FT                   GRLVPVEGAIASPGQMPTIQSLSAGGDSIGARAYRSGETVVVQNVEALDNDVAYGGLRS
FT                   VACAPMGTHGVVLMGQTSHDAFDAFNLRLVEVLVTYAAVVLDRLGREQKLREAKETAEQ
FT                   VNEMKSAFLANMSHEIRTPLTSIIGFAEAIGDEVSGGDPTVSRFAGLIEKGGRRLLETL
FT                   DAVLNLSKLEAEEMELALAPLNVAEQAADTGALFEQQAEKAGIDLRVDVPSGPLWARAD
FT                   EGALRIVLRNLVSNAVKYTGDGGRVWIRARRAEDQAVLEVEDTGQGMDPAAVSTLFEAF
FT                   KQASEGKGREYEGTGLGLAVTKQAVDQMEGTIDVDTEKGVGSRFVVRLPRPAPDETDA"
     MESDEPFSAP FSRSSFSEPA GWGPDTNAPA AVYADPGADV DPERSFGRVL DLATRLFEAP        60
     MGIGTLHANG QPRVVAADGL RDAGLQDEGD GIKARLCTRT LRSPGATVVT NATDDDRLAD       120
     HPWVAGDPGI RFYAGTPLVG PQGHRIGSLC VLDTEAQSPP PADVDRLEGL AEMIVNELEL       180
     HRQADAWDRA RQQYEAIFNH TYQFTGLLTP DGILVEANDT ALEFGGLERE EVVGTPFWDT       240
     HWWQTGPETQ QKLRAAVEQA AEGEFVQYEA DVQGADETRT IDFSIRPVTD GDGSVTMLIP       300
     EGRDITDRKR QERQLRKEKQ KTEEALQARD ALLGSITENI SEGIYRSTPD DGLVYANEAL       360
     ADMLRHRSVD ALLEADPVHF YADPDQRAQV IQQSNRNDGI TGVEVEFRRT DGTTFTGLLS       420
     ATTVRGPDGA VQYYDGAVTE ITEQKRQEQQ LRRSRERWRR LVEKLEDGLH ISVDGEIRYI       480
     NPAGAAIVGA ETPEDIVGRS LQEFVVSERT QQDVVEDRLR TVYQERASTP PRELEIIGLD       540
     GARRVIESYT VPIEFDGEQA GQTVFRDITE QKEMEQALRE REARLRSITE NVSDGIYRST       600
     PNEGLVYANR AFADIFGYES VEAILQIDPI ELYANPDARS ENRRITKEQD HIDAAEAEFR       660
     RKDGSTFTGL VSATTVRDEN GEVLYYDGAI TDITEQKEQA RTLRDRQQKL ESLYTATRHL       720
     LRAETPDAVA TRIQDVLQDV FDYPLAGVDF AEDGRLVPVE GAIASPGQMP TIQSLSAGGD       780
     SIGARAYRSG ETVVVQNVEA LDNDVAYGGL RSVACAPMGT HGVVLMGQTS HDAFDAFNLR       840
     LVEVLVTYAA VVLDRLGREQ KLREAKETAE QVNEMKSAFL ANMSHEIRTP LTSIIGFAEA       900
     IGDEVSGGDP TVSRFAGLIE KGGRRLLETL DAVLNLSKLE AEEMELALAP LNVAEQAADT       960
     GALFEQQAEK AGIDLRVDVP SGPLWARADE GALRIVLRNL VSNAVKYTGD GGRVWIRARR      1020
     AEDQAVLEVE DTGQGMDPAA VSTLFEAFKQ ASEGKGREYE GTGLGLAVTK QAVDQMEGTI      1080
     DVDTEKGVGS RFVVRLPRPA PDETDA                                           1106
//

If you have problems or comments...

PBIL Back to PBIL home page