(data stored in ACNUC30630 zone)

EMBL: FP565814.PE102

FP565814.PE102       Location/Qualifiers
FT   CDS             complement(124791..125036)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00102"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00102"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23023"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R8"
FT                   /protein_id="CBH23023.1"
FT                   /translation="MGEFRAPHATGPLGDGVEKGQPRTARSNAERSAAPPTRTTTGRLV
FT                   RAGRFSNAPPAGASTGPEHARGTTFAFLKGKNPSFF"
     MGEFRAPHAT GPLGDGVEKG QPRTARSNAE RSAAPPTRTT TGRLVRAGRF SNAPPAGAST        60
     GPEHARGTTF AFLKGKNPSF F                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page