(data stored in ACNUC30630 zone)

EMBL: FP565814.PE108

FP565814.PE108       Location/Qualifiers
FT   CDS             129676..130497
FT                   /transl_table=11
FT                   /locus_tag="SRM_00108"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing CAAX amino terminal protease domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00108"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23029"
FT                   /db_xref="GOA:D5H4S4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S4"
FT                   /protein_id="CBH23029.1"
FT                   /translation="MLIYAIRTTQYEMDPPDRRAVPSRNCPPSSPRSSPMPSWHAYHRA
FT                   TRSATYGFLSALPLFVLYETMIVLVNLDATRPVRVEAGVWIKELLMMTGASGGLGLALL
FT                   VVGGGGAAYLLDRHRDIPLRSRYFVGLVGESAAYAVGVALVVSSAVGALFAAIPPADGV
FT                   LWTQLALSIGAGLYEELVFRVLLVGGLFLLFRALMETSTRVYLVAALLGAALFSGAHYV
FT                   GPLGDPFALPSFAFRFLFGLALNALFLARGFGVAAWTHALYDVMVVTGMLG"
     MLIYAIRTTQ YEMDPPDRRA VPSRNCPPSS PRSSPMPSWH AYHRATRSAT YGFLSALPLF        60
     VLYETMIVLV NLDATRPVRV EAGVWIKELL MMTGASGGLG LALLVVGGGG AAYLLDRHRD       120
     IPLRSRYFVG LVGESAAYAV GVALVVSSAV GALFAAIPPA DGVLWTQLAL SIGAGLYEEL       180
     VFRVLLVGGL FLLFRALMET STRVYLVAAL LGAALFSGAH YVGPLGDPFA LPSFAFRFLF       240
     GLALNALFLA RGFGVAAWTH ALYDVMVVTG MLG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page