(data stored in ACNUC30630 zone)

EMBL: FP565814.PE121

FP565814.PE121       Location/Qualifiers
FT   CDS             146033..152641
FT                   /transl_table=11
FT                   /locus_tag="SRM_00121"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23042"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T7"
FT                   /protein_id="CBH23042.1"
FT                   /translation="MASPSSLCSVAQMPMGAGATSVPAPDSPHSLRTSLLRYAMPFVTL
FT                   RFSTITRRFASLLNGLAWLRVGTALLLGLAMLGMSTEPVAAQSITSFQPESGNPGTTVR
FT                   IYGSGFDSTPSNNEVKIGGTSATVTAATPTQLTVEVPTGVTGIAEIDVTVGGSTVTAGR
FT                   RFVALKASQGARDYTFATHNFAKTQPGAVAWADFDQDGDQDIVIAGTNRDDKSNPHTQL
FT                   YENTSSGFLERASGIVNVGDPGATLEWGDFDQDGDQDLFVAGKNENLDDSYVAQIYENE
FT                   GGGSFQAVGADLTGVAEAGAAWGDYDNDGDLDLVVTGEKSNGNPLTILYENEGGGTFTP
FT                   AGAGLTNVLASSADWGDVNNDGRLDLVVTGRNSNFDASTTVYWNRDDGTFQSFQTDVVD
FT                   VRGNGEAEFGDYDQDGNLDLAVAGRGNGYNSGIYQGDGTGNFTRINADILDVREGPTVE
FT                   WGDMEGDGDLDLLIAGAWGESRRRETVLYRNVGDTSFVAAEAGLPGVQDADAEWGDMNG
FT                   DGVLDLALLGIDSENNRVTTVYRSDGDGSPVTSPNFNAQGGVNEVVAKWTESPSEDEDV
FT                   TKYNVYRLTSEFPSKDPSGLTPIATVETPATSYTDGSVTAGTEYYYRVTAVDSDGLESQ
FT                   LSDRGLATPRASDLTITSFDTRSGIRGMTLKVHGNGFDTTPSNNSVSIGGTSAPVTAAT
FT                   STELTVEVPAGVTGPAPLSVTVSGVTVTAGRRFLALKATQGARAYTATGGNLVPTQPGA
FT                   IAWADFDQDGDQDIVVAGRDRVATSPKNPPKTRLYENTSSGFFEVGAGLVNVGTKDDFI
FT                   ASPTTFVKWGDFDQDGDPDLFIGGHNDRLPNKTYVSRIYENEGGGEFQEVGADLTPVAN
FT                   GAADWGDYDNDGDLDLIVTGRREGDDAAQTTLYRNDGAGEFTPVDAGLTDVWKSSVDWG
FT                   DVDNDGRLDLVITGQANNFNQSTTIYRNEGGGSFQSLQTSVVDVGGQGAAEFGDYDEDG
FT                   DLDLAIAGNPSDSKRSGAIYQGDGTGTFTKLNVGILDVRGDATVAWGDMEGDGDLDLLV
FT                   AGSDADGGSIKTVLYRNVGDTSFVDTGANLPDLRRVDADWGDTNGDGVLDLALLGLGNN
FT                   GNDVTTIYRSDGDGSPVVASDLGVASELRDVDLTWTASPSEDGDVVGYNVYRDTAPIDS
FT                   SAGPSGMTPVATVDTPATSYTDASAETGTQYHYRVAALDSSDLESGFTAEVTATPIQPL
FT                   VFSGFTPESGAPDTSVTIYGGGFSTTASENTVTFGSATATVTNATQNSLAVTVPAGVVG
FT                   PTTITVEKSGESVTAARRFTALQARTTVRSLTGTDVGLDGLRNGSVALGDLNGDNMIDV
FT                   AMVGEGAGGTPTTRLYENNGNGTYTAMNAGLTGVTDGSVALGDLNGDNRLDVVIAGEKD
FT                   DGTPVTKLYRNDGGGSFTAMNAGLPGLRSGSVALGDLNGNNMIDVAMVGEGAGGTPTTR
FT                   LYSNDGGGSFTAMNAGLTDLTNGSVALGDLNGDNRLDVAVLGEQADGTPTTRLYQNDGG
FT                   GSFSALSSLTGLTSGSIALGDLNGDNMLDVATVGEESGGTPVTRLYSNEGSDSFSALNA
FT                   GLTGVSDGAVALGDLNGNNRIDLAIAGTDADGNGVLDAYRNTPEGWTAVGPGPINVVPQ
FT                   RGGVAFGDAEGDGDLDLVAVGNGVGSESTPGAGVFENVYPTPSGVTASAGTGEAALDWQ
FT                   KTTGSQLATYRLYRSTAPIDSLGDPSGLTPFDSVSAGTTSYTDADLDEGQTYYYRVTAV
FT                   AETGEGSPLSAQNYAFLYPGSVTADVTRSFDDASSTEDYRLVALPGQVDRPLESTLDGE
FT                   AGTEWQAYWDDGSDSDFLRRFDGSEAFTLERGRGFWLTSQSDWTVEDSLETVDLKNDTS
FT                   TTVPLNSGWTIISNPLGKSVDWALVERANGGDLQPLWEFGGTFTQAQSFASASTGTAYY
FT                   FFNDTGKDSLTVPYPGAPQFREVPKTGQAENAMVALSATSARGDAPASTVRVGIAETED
FT                   ARQSVVAPPGRFAETSLRIEAPGEADSKRAGTLMAERRPRGDEPGQTFRLRLTHRADGP
FT                   LQLTAEHLGAIDGRAVALLHRSAGKTYDLREEETVEIEPEAETTELKVAIGTDSYVKDQ
FT                   TDKVLPDEVTLTSYPNPARQQGTVEYALPEKTEVTLRLYDVLGREVATIAQGRKTAGRH
FT                   RVQLEVGRLASGVYFGRLQVGDQTLTQKITVVR"
     MASPSSLCSV AQMPMGAGAT SVPAPDSPHS LRTSLLRYAM PFVTLRFSTI TRRFASLLNG        60
     LAWLRVGTAL LLGLAMLGMS TEPVAAQSIT SFQPESGNPG TTVRIYGSGF DSTPSNNEVK       120
     IGGTSATVTA ATPTQLTVEV PTGVTGIAEI DVTVGGSTVT AGRRFVALKA SQGARDYTFA       180
     THNFAKTQPG AVAWADFDQD GDQDIVIAGT NRDDKSNPHT QLYENTSSGF LERASGIVNV       240
     GDPGATLEWG DFDQDGDQDL FVAGKNENLD DSYVAQIYEN EGGGSFQAVG ADLTGVAEAG       300
     AAWGDYDNDG DLDLVVTGEK SNGNPLTILY ENEGGGTFTP AGAGLTNVLA SSADWGDVNN       360
     DGRLDLVVTG RNSNFDASTT VYWNRDDGTF QSFQTDVVDV RGNGEAEFGD YDQDGNLDLA       420
     VAGRGNGYNS GIYQGDGTGN FTRINADILD VREGPTVEWG DMEGDGDLDL LIAGAWGESR       480
     RRETVLYRNV GDTSFVAAEA GLPGVQDADA EWGDMNGDGV LDLALLGIDS ENNRVTTVYR       540
     SDGDGSPVTS PNFNAQGGVN EVVAKWTESP SEDEDVTKYN VYRLTSEFPS KDPSGLTPIA       600
     TVETPATSYT DGSVTAGTEY YYRVTAVDSD GLESQLSDRG LATPRASDLT ITSFDTRSGI       660
     RGMTLKVHGN GFDTTPSNNS VSIGGTSAPV TAATSTELTV EVPAGVTGPA PLSVTVSGVT       720
     VTAGRRFLAL KATQGARAYT ATGGNLVPTQ PGAIAWADFD QDGDQDIVVA GRDRVATSPK       780
     NPPKTRLYEN TSSGFFEVGA GLVNVGTKDD FIASPTTFVK WGDFDQDGDP DLFIGGHNDR       840
     LPNKTYVSRI YENEGGGEFQ EVGADLTPVA NGAADWGDYD NDGDLDLIVT GRREGDDAAQ       900
     TTLYRNDGAG EFTPVDAGLT DVWKSSVDWG DVDNDGRLDL VITGQANNFN QSTTIYRNEG       960
     GGSFQSLQTS VVDVGGQGAA EFGDYDEDGD LDLAIAGNPS DSKRSGAIYQ GDGTGTFTKL      1020
     NVGILDVRGD ATVAWGDMEG DGDLDLLVAG SDADGGSIKT VLYRNVGDTS FVDTGANLPD      1080
     LRRVDADWGD TNGDGVLDLA LLGLGNNGND VTTIYRSDGD GSPVVASDLG VASELRDVDL      1140
     TWTASPSEDG DVVGYNVYRD TAPIDSSAGP SGMTPVATVD TPATSYTDAS AETGTQYHYR      1200
     VAALDSSDLE SGFTAEVTAT PIQPLVFSGF TPESGAPDTS VTIYGGGFST TASENTVTFG      1260
     SATATVTNAT QNSLAVTVPA GVVGPTTITV EKSGESVTAA RRFTALQART TVRSLTGTDV      1320
     GLDGLRNGSV ALGDLNGDNM IDVAMVGEGA GGTPTTRLYE NNGNGTYTAM NAGLTGVTDG      1380
     SVALGDLNGD NRLDVVIAGE KDDGTPVTKL YRNDGGGSFT AMNAGLPGLR SGSVALGDLN      1440
     GNNMIDVAMV GEGAGGTPTT RLYSNDGGGS FTAMNAGLTD LTNGSVALGD LNGDNRLDVA      1500
     VLGEQADGTP TTRLYQNDGG GSFSALSSLT GLTSGSIALG DLNGDNMLDV ATVGEESGGT      1560
     PVTRLYSNEG SDSFSALNAG LTGVSDGAVA LGDLNGNNRI DLAIAGTDAD GNGVLDAYRN      1620
     TPEGWTAVGP GPINVVPQRG GVAFGDAEGD GDLDLVAVGN GVGSESTPGA GVFENVYPTP      1680
     SGVTASAGTG EAALDWQKTT GSQLATYRLY RSTAPIDSLG DPSGLTPFDS VSAGTTSYTD      1740
     ADLDEGQTYY YRVTAVAETG EGSPLSAQNY AFLYPGSVTA DVTRSFDDAS STEDYRLVAL      1800
     PGQVDRPLES TLDGEAGTEW QAYWDDGSDS DFLRRFDGSE AFTLERGRGF WLTSQSDWTV      1860
     EDSLETVDLK NDTSTTVPLN SGWTIISNPL GKSVDWALVE RANGGDLQPL WEFGGTFTQA      1920
     QSFASASTGT AYYFFNDTGK DSLTVPYPGA PQFREVPKTG QAENAMVALS ATSARGDAPA      1980
     STVRVGIAET EDARQSVVAP PGRFAETSLR IEAPGEADSK RAGTLMAERR PRGDEPGQTF      2040
     RLRLTHRADG PLQLTAEHLG AIDGRAVALL HRSAGKTYDL REEETVEIEP EAETTELKVA      2100
     IGTDSYVKDQ TDKVLPDEVT LTSYPNPARQ QGTVEYALPE KTEVTLRLYD VLGREVATIA      2160
     QGRKTAGRHR VQLEVGRLAS GVYFGRLQVG DQTLTQKITV VR                         2202
//

If you have problems or comments...

PBIL Back to PBIL home page