(data stored in ACNUC30630 zone)

EMBL: FP565814.PE124

FP565814.PE124       Location/Qualifiers
FT   CDS             154235..155065
FT                   /transl_table=11
FT                   /locus_tag="SRM_00124"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00124"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23045"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U0"
FT                   /protein_id="CBH23045.1"
FT                   /translation="MISGFLNTRAFTCCCTALVAVLLLAGCGSSKSSMDVSGVQEAEQA
FT                   AVPIITVDQYIDMSDLQDGGSVASGEGGGGLVQRILDSESFDLSPMADLLRERTYGTYS
FT                   ERLPTRVMSEEEVIQADRYKNFTLLDEESRDDRMQRVNRLEVPDGYKQYNVGQGSVFGD
FT                   RQQQMFGAVPETADAILLVSADYEMVEDNPFWYWFLPVSPDRAYIEATVRMEMLDREGN
FT                   EIMEIVQAARSNNHVNTVGGITAEPGKIQPLCTEATEKAVEAIDTATKQELTGT"
     MISGFLNTRA FTCCCTALVA VLLLAGCGSS KSSMDVSGVQ EAEQAAVPII TVDQYIDMSD        60
     LQDGGSVASG EGGGGLVQRI LDSESFDLSP MADLLRERTY GTYSERLPTR VMSEEEVIQA       120
     DRYKNFTLLD EESRDDRMQR VNRLEVPDGY KQYNVGQGSV FGDRQQQMFG AVPETADAIL       180
     LVSADYEMVE DNPFWYWFLP VSPDRAYIEA TVRMEMLDRE GNEIMEIVQA ARSNNHVNTV       240
     GGITAEPGKI QPLCTEATEK AVEAIDTATK QELTGT                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page