(data stored in ACNUC30630 zone)

EMBL: FP565814.PE14

FP565814.PE14        Location/Qualifiers
FT   CDS             12675..12839
FT                   /transl_table=11
FT                   /locus_tag="SRM_00014"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00014"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22935"
FT                   /db_xref="GOA:D5H4I0"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I0"
FT                   /protein_id="CBH22935.1"
FT                   /translation="MSSTQIFQVIYALIAIFGTSLTVIRLQAGDWLAALWPALIAGFCV
FT                   YRLFTVTEE"
     MSSTQIFQVI YALIAIFGTS LTVIRLQAGD WLAALWPALI AGFCVYRLFT VTEE              54
//

If you have problems or comments...

PBIL Back to PBIL home page