(data stored in ACNUC30630 zone)

EMBL: FP565814.PE151

FP565814.PE151       Location/Qualifiers
FT   CDS             complement(185477..186403)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00151"
FT                   /product="Conserved hypothetical protein containing GumN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23072"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W7"
FT                   /protein_id="CBH23072.1"
FT                   /translation="MSTSTRSRYGLRHVFGLLLAAVLAAPALAQPACAQGTSATPHMLW
FT                   RVASEANGTEGYLVGSVHVMKKEAYPLDSVFREAFSEADVLVLEANLDSMQVKAKTLVR
FT                   ELALYPPGKTLKKELPDETYAMLEKRAEKIGLNLAQMQRMEPWMVSIMIPTRQMQKAGY
FT                   SQNQGLDRHFFDKAKKAGTSVRALETAEEQMRFFDDLPPEKQEAYLRQSLKKADRTVEN
FT                   FDKIVRYWRTGNASGIEEMMVEQMKNDAPALYERLITERNATWMPRLTEILESEALPMI
FT                   VVGAGHVVGANGLVELLREKGYRVEQL"
     MSTSTRSRYG LRHVFGLLLA AVLAAPALAQ PACAQGTSAT PHMLWRVASE ANGTEGYLVG        60
     SVHVMKKEAY PLDSVFREAF SEADVLVLEA NLDSMQVKAK TLVRELALYP PGKTLKKELP       120
     DETYAMLEKR AEKIGLNLAQ MQRMEPWMVS IMIPTRQMQK AGYSQNQGLD RHFFDKAKKA       180
     GTSVRALETA EEQMRFFDDL PPEKQEAYLR QSLKKADRTV ENFDKIVRYW RTGNASGIEE       240
     MMVEQMKNDA PALYERLITE RNATWMPRLT EILESEALPM IVVGAGHVVG ANGLVELLRE       300
     KGYRVEQL                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page