(data stored in ACNUC30630 zone)

EMBL: FP565814.PE162

FP565814.PE162       Location/Qualifiers
FT   CDS             199320..199565
FT                   /transl_table=11
FT                   /locus_tag="SRM_00162"
FT                   /product="Conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00162"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23083"
FT                   /db_xref="GOA:D5H4X8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X8"
FT                   /protein_id="CBH23083.1"
FT                   /translation="MWAEIAIALVVIAAAGTAFLVLRGGASPRPSSRNRQIETHRRRRR
FT                   QARTKDAGQDDGIGEANPTEDRRPGTDAISRWSDSA"
     MWAEIAIALV VIAAAGTAFL VLRGGASPRP SSRNRQIETH RRRRRQARTK DAGQDDGIGE        60
     ANPTEDRRPG TDAISRWSDS A                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page