(data stored in ACNUC30630 zone)

EMBL: FP565814.PE173

FP565814.PE173       Location/Qualifiers
FT   CDS             complement(217251..218870)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00173"
FT                   /product="putative membrane protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00173"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23094"
FT                   /db_xref="GOA:D5H4Y9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y9"
FT                   /protein_id="CBH23094.1"
FT                   /translation="MSSALRAWLHTALSDLRTRLRDRRLLMMVAACVYLGHLVLAGRIE
FT                   LTLVDRSYRGAANAAWMGTVLSLTAAFLLTLFGFYLVRGALSRERQGRTAPLVAASPVR
FT                   SVTYLLGKWTSGTLFLLVLAGSMAVSLAVLFVLRGEGLPAPAPLLTPFLLFVVPTAAVV
FT                   TAVALAFECLPGLGGTVGGILYFFGAVAATVAPVLGAAPVDLLGMGVIHDSMSQAVLAQ
FT                   YPEADPGAMFSFGYYRAPAEQLKTVQWDGVAVTADLLARRAGLVLAGGALAAGAALPFD
FT                   RFDPSPSWRATLRSALPGPNTSTPKTEATSTEPPATAGPPTAGHPSGPEGRPDAPAPAE
FT                   SAPWSLLGSLSAPVALRPFGLFAVECRRALRRRSGTWQVGALVLVGAGLWVPGSTGLLV
FT                   VAWLWPLPLWSDLGARETATRTAPLVASSPYPRAQRVAAWAVGAAVPLALLAGPLLLGG
FT                   HWRALVGVLFVPALGLAAGRLSGTPRLFEIVYLVLWYVGLASRQAALDFGGVAHAPPGT
FT                   LVGYGLAAAVLLVGAVTGSRTA"
     MSSALRAWLH TALSDLRTRL RDRRLLMMVA ACVYLGHLVL AGRIELTLVD RSYRGAANAA        60
     WMGTVLSLTA AFLLTLFGFY LVRGALSRER QGRTAPLVAA SPVRSVTYLL GKWTSGTLFL       120
     LVLAGSMAVS LAVLFVLRGE GLPAPAPLLT PFLLFVVPTA AVVTAVALAF ECLPGLGGTV       180
     GGILYFFGAV AATVAPVLGA APVDLLGMGV IHDSMSQAVL AQYPEADPGA MFSFGYYRAP       240
     AEQLKTVQWD GVAVTADLLA RRAGLVLAGG ALAAGAALPF DRFDPSPSWR ATLRSALPGP       300
     NTSTPKTEAT STEPPATAGP PTAGHPSGPE GRPDAPAPAE SAPWSLLGSL SAPVALRPFG       360
     LFAVECRRAL RRRSGTWQVG ALVLVGAGLW VPGSTGLLVV AWLWPLPLWS DLGARETATR       420
     TAPLVASSPY PRAQRVAAWA VGAAVPLALL AGPLLLGGHW RALVGVLFVP ALGLAAGRLS       480
     GTPRLFEIVY LVLWYVGLAS RQAALDFGGV AHAPPGTLVG YGLAAAVLLV GAVTGSRTA        539
//

If you have problems or comments...

PBIL Back to PBIL home page