(data stored in ACNUC30630 zone)

EMBL: FP565814.PE18

FP565814.PE18        Location/Qualifiers
FT   CDS             17473..18567
FT                   /transl_table=11
FT                   /locus_tag="SRM_00018"
FT                   /product="Conserved hypothetical protein containing
FT                   GTP-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00018"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22939"
FT                   /db_xref="GOA:D5H4I4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I4"
FT                   /protein_id="CBH22939.1"
FT                   /translation="MSLQCGLVGLPNVGKSTIFNALSSAGAEADNYPFCTVDPNVGVVP
FT                   VPDDRLPRVAELAGSPETIPTSIEFVDIAGLVEGAAEGEGLGNQFLAQIREVDAIIHVV
FT                   RCFEDEEVAHVAGSVDPTRDVEVINTELLLKDLETVEKRLDTVKTAAKKGDQEAAEELE
FT                   VFERLHDHLSEGAWARSFEAGAAEQPLVDELFLVTDKPVLYVANVGENDLPDGNAYVDQ
FT                   LRPIAQNEGTRVVVTSAELEAQLTELDPEERQLFLDDSGLQRAGLERLIHAAYDVLDLI
FT                   TFFTADEKGAYAWAIEEGTRAPQAAGEVHSDFEQGFIKAETIHFSDFDEAGSEAAAREA
FT                   GLLRTEGKDYVVEDGDVMEFRFNV"
     MSLQCGLVGL PNVGKSTIFN ALSSAGAEAD NYPFCTVDPN VGVVPVPDDR LPRVAELAGS        60
     PETIPTSIEF VDIAGLVEGA AEGEGLGNQF LAQIREVDAI IHVVRCFEDE EVAHVAGSVD       120
     PTRDVEVINT ELLLKDLETV EKRLDTVKTA AKKGDQEAAE ELEVFERLHD HLSEGAWARS       180
     FEAGAAEQPL VDELFLVTDK PVLYVANVGE NDLPDGNAYV DQLRPIAQNE GTRVVVTSAE       240
     LEAQLTELDP EERQLFLDDS GLQRAGLERL IHAAYDVLDL ITFFTADEKG AYAWAIEEGT       300
     RAPQAAGEVH SDFEQGFIKA ETIHFSDFDE AGSEAAAREA GLLRTEGKDY VVEDGDVMEF       360
     RFNV                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page