(data stored in ACNUC30630 zone)

EMBL: FP565814.PE182

FP565814.PE182       Location/Qualifiers
FT   CDS             complement(228033..228827)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00182"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00182"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23103"
FT                   /db_xref="GOA:D5H4Z8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z8"
FT                   /protein_id="CBH23103.1"
FT                   /translation="MPSSGSFMLSPAPAPCPSGRRFCRAQLTHLPAMGNANASQSPETD
FT                   AGKEAGANREADADRKARAAGEEETQGGTGPRPGSPPGPDSSSGPAPNSGSDPNSGPGS
FT                   SHGGAGRQTEASLPGTGRAGEKEESASSARARPTGTQPARRQRDWDAFAFQHEKLKHLT
FT                   TVGLVLSGGIITLFQSEMMEPSPLALIALVLPVVSSMLTLAAQVSLGNEASTTEPMAAE
FT                   RTRDSFGVPVAVHWVGLAALFLLASSLGWLASFFFRDTGLLP"
     MPSSGSFMLS PAPAPCPSGR RFCRAQLTHL PAMGNANASQ SPETDAGKEA GANREADADR        60
     KARAAGEEET QGGTGPRPGS PPGPDSSSGP APNSGSDPNS GPGSSHGGAG RQTEASLPGT       120
     GRAGEKEESA SSARARPTGT QPARRQRDWD AFAFQHEKLK HLTTVGLVLS GGIITLFQSE       180
     MMEPSPLALI ALVLPVVSSM LTLAAQVSLG NEASTTEPMA AERTRDSFGV PVAVHWVGLA       240
     ALFLLASSLG WLASFFFRDT GLLP                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page