(data stored in ACNUC30630 zone)

EMBL: FP565814.PE184

FP565814.PE184       Location/Qualifiers
FT   CDS             complement(229829..230173)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00184"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00184"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23105"
FT                   /db_xref="UniProtKB/TrEMBL:D5H500"
FT                   /protein_id="CBH23105.1"
FT                   /translation="MRTGRSSTHRGRPSIRGQPDLCRSIQGTAMPNRGSRCRGSFPRRR
FT                   ASRTALHDRTLLIALIHATVRCFSVSFPRRPVAILAFGLLAGLLGAKTSFAQSPPGGRV
FT                   LPADFVQHRI"
     MRTGRSSTHR GRPSIRGQPD LCRSIQGTAM PNRGSRCRGS FPRRRASRTA LHDRTLLIAL        60
     IHATVRCFSV SFPRRPVAIL AFGLLAGLLG AKTSFAQSPP GGRVLPADFV QHRI             114
//

If you have problems or comments...

PBIL Back to PBIL home page