(data stored in ACNUC30630 zone)

EMBL: FP565814.PE195

FP565814.PE195       Location/Qualifiers
FT   CDS             complement(240443..241006)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00195"
FT                   /product="Putative PKD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00195"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23116"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D5H511"
FT                   /protein_id="CBH23116.1"
FT                   /translation="MSDPPSDSGVPTAPGRGRPTLHIGGATVPEETVVISVSGGTILEY
FT                   ELSDEAQDPALTDGSRIEARFPSYGTYNVTAYVDDGSGTGESVDAILSKPVCIAPCPHL
FT                   NISPSGTVPTGAPVTFDAGASAGDATGYEWTIDGPEPARGTGETLSVSFSVPGDYSATL
FT                   EVEGRNGAAARTQAGFTVAATVSA"
     MSDPPSDSGV PTAPGRGRPT LHIGGATVPE ETVVISVSGG TILEYELSDE AQDPALTDGS        60
     RIEARFPSYG TYNVTAYVDD GSGTGESVDA ILSKPVCIAP CPHLNISPSG TVPTGAPVTF       120
     DAGASAGDAT GYEWTIDGPE PARGTGETLS VSFSVPGDYS ATLEVEGRNG AAARTQAGFT       180
     VAATVSA                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page