(data stored in ACNUC30630 zone)

EMBL: FP565814.PE205

FP565814.PE205       Location/Qualifiers
FT   CDS             251539..252435
FT                   /transl_table=11
FT                   /locus_tag="SRM_00205"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="Responsible for energy coupling to the transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00205"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23126"
FT                   /db_xref="GOA:D5H521"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H521"
FT                   /protein_id="CBH23126.1"
FT                   /translation="MTLTIENVSKTYPNGTRALDDVSLTIPPGMFGLLGPNGAGKSTLM
FT                   RTVAALQEPDTGSVHLGDINALEEKQTLRRRLGYLPQEVGVYDNVSAETLLDHFATLKG
FT                   ITDRSERRRVVDALLNRVNLDGARDQNLGGYSGGMKRRFGIAVALIGDPDLIIVDEPTA
FT                   GLDPAERVRFLNLLSEIGEDSVVLLSTHIVADVRELCTQMAIIREGEIIFEGAPEAAIA
FT                   DLEGQIWRKTVTKETLPEHEETCNVVSTKLVAGRPVIRVHASARPGPDFEAADPDLEDV
FT                   YFTQMRTGAREDAPVVA"
     MTLTIENVSK TYPNGTRALD DVSLTIPPGM FGLLGPNGAG KSTLMRTVAA LQEPDTGSVH        60
     LGDINALEEK QTLRRRLGYL PQEVGVYDNV SAETLLDHFA TLKGITDRSE RRRVVDALLN       120
     RVNLDGARDQ NLGGYSGGMK RRFGIAVALI GDPDLIIVDE PTAGLDPAER VRFLNLLSEI       180
     GEDSVVLLST HIVADVRELC TQMAIIREGE IIFEGAPEAA IADLEGQIWR KTVTKETLPE       240
     HEETCNVVST KLVAGRPVIR VHASARPGPD FEAADPDLED VYFTQMRTGA REDAPVVA         298
//

If you have problems or comments...

PBIL Back to PBIL home page