(data stored in ACNUC30630 zone)

EMBL: FP565814.PE214

FP565814.PE214       Location/Qualifiers
FT   CDS             261647..262606
FT                   /transl_table=11
FT                   /locus_tag="SRM_00214"
FT                   /product="Conserved hypothetical protein containing
FT                   putative HPr kinase/phosphorylase (HPrK/P) (HPr(Ser)
FT                   kinase/phosphorylase) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00214"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23135"
FT                   /db_xref="UniProtKB/TrEMBL:D5H530"
FT                   /protein_id="CBH23135.1"
FT                   /translation="MTRHLRTNTHHKVAKRINSYKAHGLRIDSEIGMPMFRVWERETGD
FT                   TADLEILEARLTEEEKVEELSDYVFSVDGNTVTYGAPDVGFVKVVGGKKILVDTGARPV
FT                   GRPVRLVVAGIGLATALHHRGYAVLHSSAVSVGGKAVLFTGHKQAGKSTMAAAFATRGY
FT                   PIVADDIVSVSVEGACTVYPGTTTPKLWQDSMSALGEQSFSAERVHPDIDKFFVSGLEA
FT                   GERERYNIGGVLSIRESENTYIEEVSFASSVRAIVEGSYISEEILSARGELESNFERCS
FT                   KVAKSSLVCELGRPKDYSEIDEVVDTVQKHIDKYDASA"
     MTRHLRTNTH HKVAKRINSY KAHGLRIDSE IGMPMFRVWE RETGDTADLE ILEARLTEEE        60
     KVEELSDYVF SVDGNTVTYG APDVGFVKVV GGKKILVDTG ARPVGRPVRL VVAGIGLATA       120
     LHHRGYAVLH SSAVSVGGKA VLFTGHKQAG KSTMAAAFAT RGYPIVADDI VSVSVEGACT       180
     VYPGTTTPKL WQDSMSALGE QSFSAERVHP DIDKFFVSGL EAGERERYNI GGVLSIRESE       240
     NTYIEEVSFA SSVRAIVEGS YISEEILSAR GELESNFERC SKVAKSSLVC ELGRPKDYSE       300
     IDEVVDTVQK HIDKYDASA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page