(data stored in ACNUC30630 zone)

EMBL: FP565814.PE236

FP565814.PE236       Location/Qualifiers
FT   CDS             complement(285307..285528)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00236"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23157"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H552"
FT                   /protein_id="CBH23157.1"
FT                   /translation="MADLTVWRPVEEQYSGSAFSGEGARQYGGRFNSPGIPVVYTAGSL
FT                   PLALVETMTGLERYDQLRRYVFFRVGIP"
     MADLTVWRPV EEQYSGSAFS GEGARQYGGR FNSPGIPVVY TAGSLPLALV ETMTGLERYD        60
     QLRRYVFFRV GIP                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page