(data stored in ACNUC30630 zone)

EMBL: FP565814.PE246

FP565814.PE246       Location/Qualifiers
FT   CDS             293574..294071
FT                   /transl_table=11
FT                   /locus_tag="SRM_00246"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00246"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23167"
FT                   /db_xref="UniProtKB/TrEMBL:D5H562"
FT                   /protein_id="CBH23167.1"
FT                   /translation="MRPLRLRYATGLALCLMLVAGPAWAQQQGTGGMQAGGTAYYTFAR
FT                   PGQNTIEVLVLGGGRSGVYEIGENVTLGKLMALAGGGGGGGNAKVTVNLFRLENGERDR
FT                   VLKERLSAFAERPQYPPLQDGDVVRIQVRQREPFGWRDVLRITTAVTSLTFTVLRIFDI
FT                   GQ"
     MRPLRLRYAT GLALCLMLVA GPAWAQQQGT GGMQAGGTAY YTFARPGQNT IEVLVLGGGR        60
     SGVYEIGENV TLGKLMALAG GGGGGGNAKV TVNLFRLENG ERDRVLKERL SAFAERPQYP       120
     PLQDGDVVRI QVRQREPFGW RDVLRITTAV TSLTFTVLRI FDIGQ                       165
//

If you have problems or comments...

PBIL Back to PBIL home page