(data stored in ACNUC30630 zone)

EMBL: FP565814.PE340

FP565814.PE340       Location/Qualifiers
FT   CDS             complement(398010..398960)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00340"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23261"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F6"
FT                   /protein_id="CBH23261.1"
FT                   /translation="MWAMTDRLVGTRVFSCLPAAFLLLTPFGLLGVGLLGAGPAAAQPT
FT                   WPEGTWTEATTGRPQVSLDWTKPSFDGDTEATSLLTSRLVLSGQYPIGKSTRLVADLPI
FT                   SRFGIDDEDAGRADGVSSTKVGNPYLGAHARLSGGWAVGGGARLPLTSGPEAPDAGDEF
FT                   RQNAADVLALATGSLADMSRVEAFGAETFTARGYGEYTLRSAGGLSARLRSGLTLLAPT
FT                   ENTDFRANVVLLDYGARAWYDGKRFRVGLGLGGRTNLNADETETFNERSIYFFDSAVQA
FT                   RFGRVRPGLTFRTPLGGEPSDLLDFAAGINVTVAL"
     MWAMTDRLVG TRVFSCLPAA FLLLTPFGLL GVGLLGAGPA AAQPTWPEGT WTEATTGRPQ        60
     VSLDWTKPSF DGDTEATSLL TSRLVLSGQY PIGKSTRLVA DLPISRFGID DEDAGRADGV       120
     SSTKVGNPYL GAHARLSGGW AVGGGARLPL TSGPEAPDAG DEFRQNAADV LALATGSLAD       180
     MSRVEAFGAE TFTARGYGEY TLRSAGGLSA RLRSGLTLLA PTENTDFRAN VVLLDYGARA       240
     WYDGKRFRVG LGLGGRTNLN ADETETFNER SIYFFDSAVQ ARFGRVRPGL TFRTPLGGEP       300
     SDLLDFAAGI NVTVAL                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page