(data stored in ACNUC30630 zone)

EMBL: FP565814.PE347

FP565814.PE347       Location/Qualifiers
FT   CDS             409815..410450
FT                   /transl_table=11
FT                   /locus_tag="SRM_00347"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00347"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23268"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G3"
FT                   /protein_id="CBH23268.1"
FT                   /translation="MQVRPVGFAGAFRRGAPPGGLVGSGGTESEPPSIPSEVKAQTPIT
FT                   RIAFGSCNDQAAPQPLWAPIRAAEPDRWIWMGDNVYGDTLNMTALDSIYARQNRRPGHR
FT                   TLRESTRVIGTWDDHDHGANDAGRSYPKRDRSQAHVLDFMDVPEDHPGRERAGVYSAHT
FT                   YGPPGKRAKVILLDTRHHRDPITRAPISGQRYFPTRRGTSWARRSGSG"
     MQVRPVGFAG AFRRGAPPGG LVGSGGTESE PPSIPSEVKA QTPITRIAFG SCNDQAAPQP        60
     LWAPIRAAEP DRWIWMGDNV YGDTLNMTAL DSIYARQNRR PGHRTLREST RVIGTWDDHD       120
     HGANDAGRSY PKRDRSQAHV LDFMDVPEDH PGRERAGVYS AHTYGPPGKR AKVILLDTRH       180
     HRDPITRAPI SGQRYFPTRR GTSWARRSGS G                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page