(data stored in ACNUC30630 zone)

EMBL: FP565814.PE383

FP565814.PE383       Location/Qualifiers
FT   CDS             complement(455740..458958)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00383"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23304"
FT                   /db_xref="GOA:D5H5J9"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR007541"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J9"
FT                   /protein_id="CBH23304.1"
FT                   /translation="MLCRRPLPDMRSVAPVASLFAFVLAGLALLGVPDARAQYFGQNKV
FT                   QYDQFDFRTLETEHFVFHFYPEEEQAVRDAARMAERWYDRHTEVFLHRFDEKKPIIFYA
FT                   NDADFQQTNVTPRPISPGTGGLTEPLRERVVMPFASSYGETDHVLGHELVHSFQFDLGL
FT                   NADSLGIQLGNLPTWLIEGMAEYLSVGRQDSHTAMWMRDAVRRDDMPSFEGLANPREYF
FT                   PYRYGQAYLAYIGGKYGDQAVTDLFKRGGQVGLDSAYVELFGVSADSLTNEWAEATRET
FT                   YEPLMKGRTPPDSAGQTVLAPETNGGRINIAPSLSPDGRYVAFISERELFSFNLYVADA
FT                   ETGEVIAELDRAGTTGHFNALRFISSSGTWSPDGRRLAFVSSEDGDNQITVWNVVDEEI
FT                   ERSFSVDGVTSMKNPAWSPDGARLAFAGTDGGISDLYVLNLETESVRQLTNDRYADLQP
FT                   TWAPDGETIAFATDRAETNLETLSPSSNMDLGLVDVSSGEVTVRAPFGDALHHNPQFAP
FT                   DGQSLYFISDQDGFKDVYRMDLSSGDRFRVTRLKTGVSGITALSPALSIASQSGDMMLS
FT                   VFADGNYTGVRRPAPEAQGTPLRAASTAGGASAARVPAAADTTTDEAGTQSADTSRVAG
FT                   LLPSPAAARDGLIASNLRDATTGLPPDSTHYDAAPYDPTLSLESISRASGIGVSVGGPF
FT                   GGGLAGGIGLRFGDMLGHRTLGVAVQAQGTFRDIGGGVSYMNQRGQLNWGGSLSHTPLI
FT                   FSANTVPFRNDAGRLVGLGSVVQRAYITSASGNASYPLSPTRRFEFSLGGTRYGFGTNV
FT                   RTAGLAPDGAEQALQDQFGDRTPKYLATASAAYVRDFTTNGLTGPLQGGRWRLEVSPTL
FT                   GSQNFVTARADVRRYFYAEPFTVALQALHVGNYGASFNDEFGIGNEYIGYPYGQGFVRG
FT                   YSVQSIANGIRENGGCTRVDNAPTTSPCAEIDRLFGTRALTTRAEIRIPLLGPERLSLI
FT                   PFRYLPTTLAPFVDAGVTWTNDAGPDLFTFDTDSADTTIPVVSAGVSARFNILGSLLLE
FT                   TYYARPFQRRDTTWELGFRISPGF"
     MLCRRPLPDM RSVAPVASLF AFVLAGLALL GVPDARAQYF GQNKVQYDQF DFRTLETEHF        60
     VFHFYPEEEQ AVRDAARMAE RWYDRHTEVF LHRFDEKKPI IFYANDADFQ QTNVTPRPIS       120
     PGTGGLTEPL RERVVMPFAS SYGETDHVLG HELVHSFQFD LGLNADSLGI QLGNLPTWLI       180
     EGMAEYLSVG RQDSHTAMWM RDAVRRDDMP SFEGLANPRE YFPYRYGQAY LAYIGGKYGD       240
     QAVTDLFKRG GQVGLDSAYV ELFGVSADSL TNEWAEATRE TYEPLMKGRT PPDSAGQTVL       300
     APETNGGRIN IAPSLSPDGR YVAFISEREL FSFNLYVADA ETGEVIAELD RAGTTGHFNA       360
     LRFISSSGTW SPDGRRLAFV SSEDGDNQIT VWNVVDEEIE RSFSVDGVTS MKNPAWSPDG       420
     ARLAFAGTDG GISDLYVLNL ETESVRQLTN DRYADLQPTW APDGETIAFA TDRAETNLET       480
     LSPSSNMDLG LVDVSSGEVT VRAPFGDALH HNPQFAPDGQ SLYFISDQDG FKDVYRMDLS       540
     SGDRFRVTRL KTGVSGITAL SPALSIASQS GDMMLSVFAD GNYTGVRRPA PEAQGTPLRA       600
     ASTAGGASAA RVPAAADTTT DEAGTQSADT SRVAGLLPSP AAARDGLIAS NLRDATTGLP       660
     PDSTHYDAAP YDPTLSLESI SRASGIGVSV GGPFGGGLAG GIGLRFGDML GHRTLGVAVQ       720
     AQGTFRDIGG GVSYMNQRGQ LNWGGSLSHT PLIFSANTVP FRNDAGRLVG LGSVVQRAYI       780
     TSASGNASYP LSPTRRFEFS LGGTRYGFGT NVRTAGLAPD GAEQALQDQF GDRTPKYLAT       840
     ASAAYVRDFT TNGLTGPLQG GRWRLEVSPT LGSQNFVTAR ADVRRYFYAE PFTVALQALH       900
     VGNYGASFND EFGIGNEYIG YPYGQGFVRG YSVQSIANGI RENGGCTRVD NAPTTSPCAE       960
     IDRLFGTRAL TTRAEIRIPL LGPERLSLIP FRYLPTTLAP FVDAGVTWTN DAGPDLFTFD      1020
     TDSADTTIPV VSAGVSARFN ILGSLLLETY YARPFQRRDT TWELGFRISP GF              1072
//

If you have problems or comments...

PBIL Back to PBIL home page