(data stored in ACNUC30630 zone)

EMBL: FP565814.PE390

FP565814.PE390       Location/Qualifiers
FT   CDS             complement(465168..465647)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00390"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23311"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K6"
FT                   /protein_id="CBH23311.1"
FT                   /translation="MDVSPADITDAMRDHPFFGGVSTEERERLIDLGQARTAASGTILF
FT                   QRGDAYRGFYLLVEGGVHVYRLSPEGRMLVLHVIRPGESFAEVPLFETDAGDTYPATAE
FT                   TLTDSALFFFPADAFLSFVDAHPRSALQDKDLIRTEDADIVLTDVRGLRHLVDSA"
     MDVSPADITD AMRDHPFFGG VSTEERERLI DLGQARTAAS GTILFQRGDA YRGFYLLVEG        60
     GVHVYRLSPE GRMLVLHVIR PGESFAEVPL FETDAGDTYP ATAETLTDSA LFFFPADAFL       120
     SFVDAHPRSA LQDKDLIRTE DADIVLTDVR GLRHLVDSA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page