(data stored in ACNUC30630 zone)

EMBL: FP565814.PE395

FP565814.PE395       Location/Qualifiers
FT   CDS             468597..469322
FT                   /transl_table=11
FT                   /locus_tag="SRM_00395"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00395"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23316"
FT                   /db_xref="GOA:D5H5L1"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L1"
FT                   /protein_id="CBH23316.1"
FT                   /translation="MGARTAAPGAPGLGRGPEARTEPVRWLSRRFPAFCSMDDPSSSET
FT                   DDAPSPSAPDAPDEVNPWVVRFFLILAFGLAFGIEGMTLVRSYLLSGEGESKTAAEKQG
FT                   APTGARGPQASDAPLRIGDDLLPATDVTERVVEMQVRAQSSGPWTFRLAVAVDNRTDTP
FT                   YRLTLRALETDDGTVLDERRTATWPPGDSTRFRAAWPMGADARPQSLTAEAQLQYAADS
FT                   TRTVRRRISFGHVPVQMER"
     MGARTAAPGA PGLGRGPEAR TEPVRWLSRR FPAFCSMDDP SSSETDDAPS PSAPDAPDEV        60
     NPWVVRFFLI LAFGLAFGIE GMTLVRSYLL SGEGESKTAA EKQGAPTGAR GPQASDAPLR       120
     IGDDLLPATD VTERVVEMQV RAQSSGPWTF RLAVAVDNRT DTPYRLTLRA LETDDGTVLD       180
     ERRTATWPPG DSTRFRAAWP MGADARPQSL TAEAQLQYAA DSTRTVRRRI SFGHVPVQME       240
     R                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page