(data stored in ACNUC30630 zone)

EMBL: FP565814.PE436

FP565814.PE436       Location/Qualifiers
FT   CDS             530559..533678
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00436"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00436"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23357"
FT                   /db_xref="GOA:D5H5Q2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q2"
FT                   /protein_id="CBH23357.1"
FT                   /translation="MGWCGTAPAMRAGRRSTRRLPIRFQIIDTATQPMQYRHSILTLAL
FT                   LGMALCVGAVQAQDRQTISGTVTSADDAAPLPGANVSVPGTTAGTATNAQGQYSLQVPT
FT                   DADSLRFSFVGFRAQTVPIAGRTTIDVALAPAAQQIDELVVVGYGEQEQGNVTGVVNKV
FT                   SSEDFNKAPTVSADRLLQGKVAGLNIKSNSGRPGGQTFIRIRGGTSINASNRPLFVVDG
FT                   VPLNDTPHSPGGLSEGRNPLNFLNPNEIKDITVLKDASAAAIYGARGANGVVLITTKQG
FT                   SGEQTRISYSGSVSSTNATGTRDVLGAPQYRDVVGEQFPDLTGDLGDANTDWQDEVFER
FT                   ALGQQHSLSFSGGSEQGDRYRIALGYQNEEGVLRTSETQRVNASVKYNRPFFDDRLDLD
FT                   INLRGSRTDDQYAPSVIETAATFAPTQPVSDESNERTGYFEWREFSNEAENNPVAAIDL
FT                   YDETGDTYRSVGNFKFTYEPAFVDGISADVNLGYDVSTGERQRFIPTNERGQVEAANPG
FT                   QVDRANFTRFSRLLDATLNYQDEFEELSSQIDVTAGYSYQDDLNKFPEISASGLSSDLL
FT                   GANSTLPASEVNTFVSETPSRLISGFGRVNYTLASKYVFTATVRRDGSSRFSPENRWGT
FT                   FPSAAVAWRVHNEDFMEPLSETLTRLKIRGSWGITGNQEIGDFQYSRLFELSNQRARVQ
FT                   FGDEFITTIRPSAVDQDLKWEETTSYNIGADYGLFGGRISGSIEYYRKETNDLLFSSIV
FT                   PAGANLSDQVLTNVGSVRNTGVEFSVDAAVYETDDFSYNARFNAATNDNELTKLTNFSS
FT                   GVRTGGISGGVGNQVQILQEGEPVNSFYVYRHKTDENGDPLTDNVDHNGDGEVNLADMY
FT                   KDTNGDGEVTSEDRTAYKSPQPDWTFGHTSQVRYDGFDLSFSLRAQLGNHVYNNVASNL
FT                   GTYNRVDEFAPSNLHASVLETNFNQPQYFSDYYVEDASFLKMDNITLGYTFDRIPGVDR
FT                   LRLYGSVSNVFVLSGYSGPEPEIGETSGVGIDNDVFPRTRTFTGGLNVQL"
     MGWCGTAPAM RAGRRSTRRL PIRFQIIDTA TQPMQYRHSI LTLALLGMAL CVGAVQAQDR        60
     QTISGTVTSA DDAAPLPGAN VSVPGTTAGT ATNAQGQYSL QVPTDADSLR FSFVGFRAQT       120
     VPIAGRTTID VALAPAAQQI DELVVVGYGE QEQGNVTGVV NKVSSEDFNK APTVSADRLL       180
     QGKVAGLNIK SNSGRPGGQT FIRIRGGTSI NASNRPLFVV DGVPLNDTPH SPGGLSEGRN       240
     PLNFLNPNEI KDITVLKDAS AAAIYGARGA NGVVLITTKQ GSGEQTRISY SGSVSSTNAT       300
     GTRDVLGAPQ YRDVVGEQFP DLTGDLGDAN TDWQDEVFER ALGQQHSLSF SGGSEQGDRY       360
     RIALGYQNEE GVLRTSETQR VNASVKYNRP FFDDRLDLDI NLRGSRTDDQ YAPSVIETAA       420
     TFAPTQPVSD ESNERTGYFE WREFSNEAEN NPVAAIDLYD ETGDTYRSVG NFKFTYEPAF       480
     VDGISADVNL GYDVSTGERQ RFIPTNERGQ VEAANPGQVD RANFTRFSRL LDATLNYQDE       540
     FEELSSQIDV TAGYSYQDDL NKFPEISASG LSSDLLGANS TLPASEVNTF VSETPSRLIS       600
     GFGRVNYTLA SKYVFTATVR RDGSSRFSPE NRWGTFPSAA VAWRVHNEDF MEPLSETLTR       660
     LKIRGSWGIT GNQEIGDFQY SRLFELSNQR ARVQFGDEFI TTIRPSAVDQ DLKWEETTSY       720
     NIGADYGLFG GRISGSIEYY RKETNDLLFS SIVPAGANLS DQVLTNVGSV RNTGVEFSVD       780
     AAVYETDDFS YNARFNAATN DNELTKLTNF SSGVRTGGIS GGVGNQVQIL QEGEPVNSFY       840
     VYRHKTDENG DPLTDNVDHN GDGEVNLADM YKDTNGDGEV TSEDRTAYKS PQPDWTFGHT       900
     SQVRYDGFDL SFSLRAQLGN HVYNNVASNL GTYNRVDEFA PSNLHASVLE TNFNQPQYFS       960
     DYYVEDASFL KMDNITLGYT FDRIPGVDRL RLYGSVSNVF VLSGYSGPEP EIGETSGVGI      1020
     DNDVFPRTRT FTGGLNVQL                                                   1039
//

If you have problems or comments...

PBIL Back to PBIL home page