(data stored in ACNUC30630 zone)

EMBL: FP565814.PE447

FP565814.PE447       Location/Qualifiers
FT   CDS             547885..549108
FT                   /transl_table=11
FT                   /locus_tag="SRM_00447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00447"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23368"
FT                   /db_xref="GOA:D5H5R3"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R3"
FT                   /protein_id="CBH23368.1"
FT                   /translation="MEAVPIFRPHCGPILCLLFCEALLFPSARGSMRRFLLTTIVGVFV
FT                   LVLAGGESVSALVGRPSGDAAKNNPESEAPPRTYAIYRASGPIAVDGRLDERDWAAAPW
FT                   TADFVDIRGRDAPTPRFRTRAKMLWDDEALYVAASLEEPDVWGTLTQRDTVVYYDDDFE
FT                   VFIDPNGTTHNYYEVEVNALETVWDLMLLKPYRDGGPAVDAWDVRGIDAAVHVQGTLND
FT                   PSDTDDGWTVEIKLPWSSLEEAAPGGRPPQAGEQWRLNFSRVDWPLAVKNGTYEKDLDT
FT                   TKAHPERNWVWSPQGAIDMHRPEHWGIVQFADAEVGTATVSVDERPNRRVKAALRRLYH
FT                   RQRAHHEAHGTYAGSLSALNASNVQLPERDFAPTLRTTQTMYEIAAPGAEGTTVHIRQD
FT                   GKVWVTGE"
     MEAVPIFRPH CGPILCLLFC EALLFPSARG SMRRFLLTTI VGVFVLVLAG GESVSALVGR        60
     PSGDAAKNNP ESEAPPRTYA IYRASGPIAV DGRLDERDWA AAPWTADFVD IRGRDAPTPR       120
     FRTRAKMLWD DEALYVAASL EEPDVWGTLT QRDTVVYYDD DFEVFIDPNG TTHNYYEVEV       180
     NALETVWDLM LLKPYRDGGP AVDAWDVRGI DAAVHVQGTL NDPSDTDDGW TVEIKLPWSS       240
     LEEAAPGGRP PQAGEQWRLN FSRVDWPLAV KNGTYEKDLD TTKAHPERNW VWSPQGAIDM       300
     HRPEHWGIVQ FADAEVGTAT VSVDERPNRR VKAALRRLYH RQRAHHEAHG TYAGSLSALN       360
     ASNVQLPERD FAPTLRTTQT MYEIAAPGAE GTTVHIRQDG KVWVTGE                     407
//

If you have problems or comments...

PBIL Back to PBIL home page