(data stored in ACNUC30630 zone)

EMBL: FP565814.PE45

FP565814.PE45        Location/Qualifiers
FT   CDS             complement(43808..44197)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00045"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00045"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22966"
FT                   /db_xref="GOA:D5H4L1"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L1"
FT                   /protein_id="CBH22966.1"
FT                   /translation="MPTLLLCPTSLTFHSRALYTYARSPFDHLQLVGRLPLSPCPARFT
FT                   IHSFHARTYAPMPDQSLTPGQALGRWILHVVVFLLSGGVAAGASALAYQAIAQTQTPLG
FT                   IYAVIFAAGGFIAYRQTERVLATEA"
     MPTLLLCPTS LTFHSRALYT YARSPFDHLQ LVGRLPLSPC PARFTIHSFH ARTYAPMPDQ        60
     SLTPGQALGR WILHVVVFLL SGGVAAGASA LAYQAIAQTQ TPLGIYAVIF AAGGFIAYRQ       120
     TERVLATEA                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page