(data stored in ACNUC30630 zone)

EMBL: FP565814.PE455

FP565814.PE455       Location/Qualifiers
FT   CDS             complement(558379..558744)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00455"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23376"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S1"
FT                   /protein_id="CBH23376.1"
FT                   /translation="MPRSIQQAKWKRASADSYTDITDAVDEGVLAATPHPDDAIDRPKG
FT                   YSVRLTLAPDSTALADALQDALLDVDPARMTLHLEGVDEPISALPVSVSKVPHLGTQNT
FT                   AELGVPSEGHDQLHPHF"
     MPRSIQQAKW KRASADSYTD ITDAVDEGVL AATPHPDDAI DRPKGYSVRL TLAPDSTALA        60
     DALQDALLDV DPARMTLHLE GVDEPISALP VSVSKVPHLG TQNTAELGVP SEGHDQLHPH       120
     F                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page