(data stored in ACNUC30630 zone)

EMBL: FP565814.PE495

FP565814.PE495       Location/Qualifiers
FT   CDS             602221..605199
FT                   /transl_table=11
FT                   /locus_tag="SRM_00495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00495"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23416"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W1"
FT                   /protein_id="CBH23416.1"
FT                   /translation="MAQTPTRKRAMTPRHALCVLLLCGAISLPVQAQSFSMVTGRNHPE
FT                   IDWRVATTEHFEIVHPARLGDIAAEAAPIAEATYDTLSATLDVAFDERIRVYLSDQDAI
FT                   VNGFAVPFGTGYTDIWVNTNDWAASFSGATSWLRLVLAHELTHIFHYEAARSGLGVWAL
FT                   ALGGSFPRVWTEGLAQYQAETWNAQRGERWLRAAVLDDALAYDDGRSLWNGRLLYASGH
FT                   SQVRYFAQQHGDSTLTDLLHHKTDVLFGLAEVHDFEAAFRATAGQSYETFYEQWRRDVN
FT                   VYYNTLASQLETLDSLQTDTLAVPGRYVDGLAYSPDTSRIAALTQHSPARPVRRLHVID
FT                   PSTGAVTRGAEGAIEPPVAWHPSGERIAFSRRTRAAHGSLVDDVFVVDADGTDERRLTH
FT                   GRRTSAPTFGPDGDRLAFVATEGGTANVHLRALKTGGTTRVTDYEGDVQITALRWHPTQ
FT                   DTLAFARVSEAERELVLYDLDTGASTALTDPATDDRRPVWSPDGSQLAYTSLRDGVPNA
FT                   FVYDLSTHTHRRATHLVRGATVHDWVPADSAFGAESSRAAPEGALVTSTALSKARDGAF
FT                   RLPAHRTARSVAPAVPGQYDDWTTTRPPRTIPQQLAPDPSLIESQGDYDALSNLTHRAS
FT                   GALPYYTSTDNFGIAGVTSWTEPLGTHTFNAAGSVSFTDPDEKSEVVATYLNRQLRPTI
FT                   GLSLFSASSSGRIYGNDLLVEDRTGGALTVRWPLDWHVAPYVSTSFSTRLRYADLNPLD
FT                   PDDFTALGPLSPPQAGQQASVRLQVLRRKKPPSRHTLVHPLDGWGLRLRATGAAEVLGG
FT                   DRSFLRGDVAGYAVYPSIGDHRVFLYGRLQAQTGASFPQDYIGFSRYDAIDLPLPGAVP
FT                   VSLGDAERVRGYRRYVLGTRAAFGRAEYRVPVASSLQTNVLGVIGLGHTTLSAFVDGGM
FT                   VWRDADLRGGTRQLGTGVEVKNALRLFGVRVGHALGVAQPAAQVGTRDEVQLYYRVQTA
FT                   LPF"
     MAQTPTRKRA MTPRHALCVL LLCGAISLPV QAQSFSMVTG RNHPEIDWRV ATTEHFEIVH        60
     PARLGDIAAE AAPIAEATYD TLSATLDVAF DERIRVYLSD QDAIVNGFAV PFGTGYTDIW       120
     VNTNDWAASF SGATSWLRLV LAHELTHIFH YEAARSGLGV WALALGGSFP RVWTEGLAQY       180
     QAETWNAQRG ERWLRAAVLD DALAYDDGRS LWNGRLLYAS GHSQVRYFAQ QHGDSTLTDL       240
     LHHKTDVLFG LAEVHDFEAA FRATAGQSYE TFYEQWRRDV NVYYNTLASQ LETLDSLQTD       300
     TLAVPGRYVD GLAYSPDTSR IAALTQHSPA RPVRRLHVID PSTGAVTRGA EGAIEPPVAW       360
     HPSGERIAFS RRTRAAHGSL VDDVFVVDAD GTDERRLTHG RRTSAPTFGP DGDRLAFVAT       420
     EGGTANVHLR ALKTGGTTRV TDYEGDVQIT ALRWHPTQDT LAFARVSEAE RELVLYDLDT       480
     GASTALTDPA TDDRRPVWSP DGSQLAYTSL RDGVPNAFVY DLSTHTHRRA THLVRGATVH       540
     DWVPADSAFG AESSRAAPEG ALVTSTALSK ARDGAFRLPA HRTARSVAPA VPGQYDDWTT       600
     TRPPRTIPQQ LAPDPSLIES QGDYDALSNL THRASGALPY YTSTDNFGIA GVTSWTEPLG       660
     THTFNAAGSV SFTDPDEKSE VVATYLNRQL RPTIGLSLFS ASSSGRIYGN DLLVEDRTGG       720
     ALTVRWPLDW HVAPYVSTSF STRLRYADLN PLDPDDFTAL GPLSPPQAGQ QASVRLQVLR       780
     RKKPPSRHTL VHPLDGWGLR LRATGAAEVL GGDRSFLRGD VAGYAVYPSI GDHRVFLYGR       840
     LQAQTGASFP QDYIGFSRYD AIDLPLPGAV PVSLGDAERV RGYRRYVLGT RAAFGRAEYR       900
     VPVASSLQTN VLGVIGLGHT TLSAFVDGGM VWRDADLRGG TRQLGTGVEV KNALRLFGVR       960
     VGHALGVAQP AAQVGTRDEV QLYYRVQTAL PF                                     992
//

If you have problems or comments...

PBIL Back to PBIL home page