(data stored in ACNUC30630 zone)

EMBL: FP565814.PE498

FP565814.PE498       Location/Qualifiers
FT   CDS             607785..608117
FT                   /transl_table=11
FT                   /locus_tag="SRM_00498"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00498"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23419"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W4"
FT                   /protein_id="CBH23419.1"
FT                   /translation="MSAATRYSTDAAASDMANLDSDIPENKHLKQAINHLEKVLEYAPM
FT                   VAEGRDATVHLTPEDWQVVADALFNMSAPDDTFPDAITDYGLTNENQTITLTTDDYDIE
FT                   IEVVAS"
     MSAATRYSTD AAASDMANLD SDIPENKHLK QAINHLEKVL EYAPMVAEGR DATVHLTPED        60
     WQVVADALFN MSAPDDTFPD AITDYGLTNE NQTITLTTDD YDIEIEVVAS                  110
//

If you have problems or comments...

PBIL Back to PBIL home page