(data stored in ACNUC30630 zone)

EMBL: FP565814.PE506

FP565814.PE506       Location/Qualifiers
FT   CDS             complement(616356..616751)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00507"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23428"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X3"
FT                   /protein_id="CBH23428.1"
FT                   /translation="MPDDRSAKVIETVADGLRLQVGDLPGDYAPTLLKAEPAAYVVGFT
FT                   AGVSRAMDVPVGNHTIRTLERGCRQGLPRDGDLGQRLADIAAGIVFDGSVTSDPDLTTI
FT                   REDGEEEGRAFVEDRSPPSLLDDLVRG"
     MPDDRSAKVI ETVADGLRLQ VGDLPGDYAP TLLKAEPAAY VVGFTAGVSR AMDVPVGNHT        60
     IRTLERGCRQ GLPRDGDLGQ RLADIAAGIV FDGSVTSDPD LTTIREDGEE EGRAFVEDRS       120
     PPSLLDDLVR G                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page