(data stored in ACNUC30630 zone)

EMBL: FP565814.PE528

FP565814.PE528       Location/Qualifiers
FT   CDS             complement(646285..647421)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00528"
FT                   /product="Conserved hypothetical protein containing M23
FT                   peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00528"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23449"
FT                   /db_xref="GOA:D5H5Z4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z4"
FT                   /protein_id="CBH23449.1"
FT                   /translation="MCVFNFVCSKRVLRPHGPCISVGPMTTLVRGKARRGNRRRAQGPN
FT                   QPGCAVHGNSRSDMTLLIASALLPLLILPGAALVWLTRRSPCRLLWGLKAAAVGGYVGL
FT                   TYHLGSWYMLSTHGRYVLLGLFAVGAGYGGWRMRHQVFWTRPRGWQWAGPGLAAVLLLL
FT                   SVVGLRQRNQAREIPAPPVNLTVPLRDGPVYVASGGSRSITNPHLKVDAPELQTWRGQR
FT                   WGLDLVQLYPSGNRASGLYPTALARYAVFGAPVYAPCDGVVETTAGSLPDRSPPARDTA
FT                   RKAGNHVLLRCAPDAYVLLAHLKQGSVRVESGDSVSPDTRLGRVGNSGNSWEPHLHISA
FT                   QDTVGTSALLDADPRPITFDGRFPIRNDVVRTNGAGRR"
     MCVFNFVCSK RVLRPHGPCI SVGPMTTLVR GKARRGNRRR AQGPNQPGCA VHGNSRSDMT        60
     LLIASALLPL LILPGAALVW LTRRSPCRLL WGLKAAAVGG YVGLTYHLGS WYMLSTHGRY       120
     VLLGLFAVGA GYGGWRMRHQ VFWTRPRGWQ WAGPGLAAVL LLLSVVGLRQ RNQAREIPAP       180
     PVNLTVPLRD GPVYVASGGS RSITNPHLKV DAPELQTWRG QRWGLDLVQL YPSGNRASGL       240
     YPTALARYAV FGAPVYAPCD GVVETTAGSL PDRSPPARDT ARKAGNHVLL RCAPDAYVLL       300
     AHLKQGSVRV ESGDSVSPDT RLGRVGNSGN SWEPHLHISA QDTVGTSALL DADPRPITFD       360
     GRFPIRNDVV RTNGAGRR                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page