(data stored in ACNUC30630 zone)

EMBL: FP565814.PE57

FP565814.PE57        Location/Qualifiers
FT   CDS             56135..56626
FT                   /transl_table=11
FT                   /locus_tag="SRM_00057"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00057"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22978"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M3"
FT                   /protein_id="CBH22978.1"
FT                   /translation="MTRQPEPGNAPEGNAPRSFGLSQSQRWGAASGLLFFLLVVGTDYA
FT                   SGVAAREWSELALDAGIVGGLVLVVFNAFRKSVLVGENEIRKVQPLWNDQSVQISEIRR
FT                   VHVPTIENGLWLYTDPDGNPVLTIGGGLEAPDELEERVIQHAPSDAAVTGLGHRANGSS
FT                   "
     MTRQPEPGNA PEGNAPRSFG LSQSQRWGAA SGLLFFLLVV GTDYASGVAA REWSELALDA        60
     GIVGGLVLVV FNAFRKSVLV GENEIRKVQP LWNDQSVQIS EIRRVHVPTI ENGLWLYTDP       120
     DGNPVLTIGG GLEAPDELEE RVIQHAPSDA AVTGLGHRAN GSS                         163
//

If you have problems or comments...

PBIL Back to PBIL home page