(data stored in ACNUC30630 zone)

EMBL: FP565814.PE571

FP565814.PE571       Location/Qualifiers
FT   CDS             705788..706072
FT                   /transl_table=11
FT                   /locus_tag="SRM_00571"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23492"
FT                   /db_xref="UniProtKB/TrEMBL:D5H637"
FT                   /protein_id="CBH23492.1"
FT                   /translation="MDTTTIIDELEGVAARLGIEVRAEAGNFRGGRCVVAGEEVIMLNT
FT                   NDLPETQLVVLAEALRDAPLDTIYLKPAVRRALEEAWAEHMSAEAPHDH"
     MDTTTIIDEL EGVAARLGIE VRAEAGNFRG GRCVVAGEEV IMLNTNDLPE TQLVVLAEAL        60
     RDAPLDTIYL KPAVRRALEE AWAEHMSAEA PHDH                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page