(data stored in ACNUC30630 zone)

EMBL: FP565814.PE581

FP565814.PE581       Location/Qualifiers
FT   CDS             714572..715489
FT                   /transl_table=11
FT                   /locus_tag="SRM_00581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23502"
FT                   /db_xref="GOA:D5H647"
FT                   /db_xref="UniProtKB/TrEMBL:D5H647"
FT                   /protein_id="CBH23502.1"
FT                   /translation="MPVRWRRRGRAFPDGDASSPRRRSDPFAPARPGIHGNKECVARIR
FT                   IDDGPPPGSAARVRTAWDDRFPTSWGPRAARRRISCHGLRRKRTSGEPPFMQFPERPFD
FT                   GEASGDGAPSYEWLDEWLCEYVDGTMDPSVEAVFEQYVEANPELRAHIERLRQTRELLC
FT                   GGEDTGAPPTAPMEAAREVEEDLLRDAAPELLASEETSRSVVALGLASSIAMALVVGFL
FT                   AGSMLVEPSTLSSGPATAIERQAAPSEGGDEASPRRGAADRGRPPRASSFSSADRLLTL
FT                   PAEAPSPSTDTGRAAPTFMTAGER"
     MPVRWRRRGR AFPDGDASSP RRRSDPFAPA RPGIHGNKEC VARIRIDDGP PPGSAARVRT        60
     AWDDRFPTSW GPRAARRRIS CHGLRRKRTS GEPPFMQFPE RPFDGEASGD GAPSYEWLDE       120
     WLCEYVDGTM DPSVEAVFEQ YVEANPELRA HIERLRQTRE LLCGGEDTGA PPTAPMEAAR       180
     EVEEDLLRDA APELLASEET SRSVVALGLA SSIAMALVVG FLAGSMLVEP STLSSGPATA       240
     IERQAAPSEG GDEASPRRGA ADRGRPPRAS SFSSADRLLT LPAEAPSPST DTGRAAPTFM       300
     TAGER                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page