(data stored in ACNUC30630 zone)

EMBL: FP565814.PE582

FP565814.PE582       Location/Qualifiers
FT   CDS             715847..716407
FT                   /transl_table=11
FT                   /locus_tag="SRM_00582"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00582"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23503"
FT                   /db_xref="GOA:D5H648"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:D5H648"
FT                   /protein_id="CBH23503.1"
FT                   /translation="MLPVLIRLDFVLATALLVAAPLGLLLASVRRPAVRGRLLAYWRAS
FT                   SLLMVTVYLMVDGRPGAFVAGNTALVAIPLALHAGDVLFVPGPASLGEGPVATWFRRWR
FT                   AGATAFCGASLLLTVPALRCAWEGAENPVCAAWLAPPRELHRALHASVDPATLGDAAVI
FT                   GGLIYGAYLVASVIRVGWAVWRS"
     MLPVLIRLDF VLATALLVAA PLGLLLASVR RPAVRGRLLA YWRASSLLMV TVYLMVDGRP        60
     GAFVAGNTAL VAIPLALHAG DVLFVPGPAS LGEGPVATWF RRWRAGATAF CGASLLLTVP       120
     ALRCAWEGAE NPVCAAWLAP PRELHRALHA SVDPATLGDA AVIGGLIYGA YLVASVIRVG       180
     WAVWRS                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page