(data stored in ACNUC30630 zone)

EMBL: FP565814.PE587

FP565814.PE587       Location/Qualifiers
FT   CDS             720047..722095
FT                   /transl_table=11
FT                   /locus_tag="SRM_00587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00587"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23508"
FT                   /db_xref="GOA:D5H653"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D5H653"
FT                   /protein_id="CBH23508.1"
FT                   /translation="MNDDPTNPGYAVLWSRLMDVTRMDGMSVSGGGGGGWDGGTKNGGR
FT                   CAVGSAFGLLIGLLVSCANPQAPSGGPRDSTPPSVVQTRPVQDTVDVSTDVGALRVEFS
FT                   EYVERSTLSQALSITPTFEQRPQFSWDGRAVEIQFPSALRDSTTYIFTFGTTLSDARGV
FT                   SLETPITVAFSTGERINRGQIEGRVVNGPSGTTQQGVDVFAYALPPGASAVRPLPDAPS
FT                   YRTQTGEGGRFSFDYMREGPYYVLALRDNNRNRQPDSQEPVAVPPRLSIRADSGAAAVP
FT                   VPWLLARRDTTAPQLQQVRPVSRQRLRLRFDEPVRLGTRAPTAWAPRDSATGTPVPVRG
FT                   VYNAPDRPNAIVVRTAPMPDARHALPLRRGAVVDTLGQPLGPDTARFRAAARADTLRTR
FT                   FRGFVPTGLGQDSTGARPLLPGVQPGVRFNQAPDSAALREGISVQDTTGAPQSVSFATD
FT                   DGTTYRLRPDPPLSPGEVVDVRVAGDVFAQPDTTVRRRFRRVTGRVLGALAGRARVVDT
FT                   TRAVEADGDAPAARPSPIRADSSRADALATPEDSLGTQRDATPPDSLLDGGPVVVNLTA
FT                   VESSIPVAPRRLTTPPDSLFEFVELPEGRYRFRAHLDRNENGRWDGGQIQPYVPAEPVT
FT                   WLREPLEARLRWTTELPVPLRIPVLVPEPTRPDASPPDTSGSAGRGR"
     MNDDPTNPGY AVLWSRLMDV TRMDGMSVSG GGGGGWDGGT KNGGRCAVGS AFGLLIGLLV        60
     SCANPQAPSG GPRDSTPPSV VQTRPVQDTV DVSTDVGALR VEFSEYVERS TLSQALSITP       120
     TFEQRPQFSW DGRAVEIQFP SALRDSTTYI FTFGTTLSDA RGVSLETPIT VAFSTGERIN       180
     RGQIEGRVVN GPSGTTQQGV DVFAYALPPG ASAVRPLPDA PSYRTQTGEG GRFSFDYMRE       240
     GPYYVLALRD NNRNRQPDSQ EPVAVPPRLS IRADSGAAAV PVPWLLARRD TTAPQLQQVR       300
     PVSRQRLRLR FDEPVRLGTR APTAWAPRDS ATGTPVPVRG VYNAPDRPNA IVVRTAPMPD       360
     ARHALPLRRG AVVDTLGQPL GPDTARFRAA ARADTLRTRF RGFVPTGLGQ DSTGARPLLP       420
     GVQPGVRFNQ APDSAALREG ISVQDTTGAP QSVSFATDDG TTYRLRPDPP LSPGEVVDVR       480
     VAGDVFAQPD TTVRRRFRRV TGRVLGALAG RARVVDTTRA VEADGDAPAA RPSPIRADSS       540
     RADALATPED SLGTQRDATP PDSLLDGGPV VVNLTAVESS IPVAPRRLTT PPDSLFEFVE       600
     LPEGRYRFRA HLDRNENGRW DGGQIQPYVP AEPVTWLREP LEARLRWTTE LPVPLRIPVL       660
     VPEPTRPDAS PPDTSGSAGR GR                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page