(data stored in ACNUC30630 zone)

EMBL: FP565814.PE607

FP565814.PE607       Location/Qualifiers
FT   CDS             740729..740947
FT                   /transl_table=11
FT                   /locus_tag="SRM_00606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00606"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23527"
FT                   /db_xref="UniProtKB/TrEMBL:D5H672"
FT                   /protein_id="CBH23527.1"
FT                   /translation="MGKGVSCIRRRLVVNEGGAVRGRAEHRSRRNARNDPQAPTKGDAY
FT                   DLRGTVTETGGEAPARSVGNSKIGRRA"
     MGKGVSCIRR RLVVNEGGAV RGRAEHRSRR NARNDPQAPT KGDAYDLRGT VTETGGEAPA        60
     RSVGNSKIGR RA                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page