(data stored in ACNUC30630 zone)

EMBL: FP565814.PE652

FP565814.PE652       Location/Qualifiers
FT   CDS             complement(790518..791090)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00652"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00652"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23573"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B8"
FT                   /protein_id="CBH23573.1"
FT                   /translation="MLPERIPIPESLHSIETGDPIATCLACDAPLLDGPTEYLVEKGYR
FT                   QYEAYDVQETVFEYAICMDCHAEMRQSFSEPSKRRCQAYLSEHVDLAARTGRLLDADSR
FT                   DPADWTRQCVVHGTPRDELEEYQVIAHCQGDELLLTHLPLLMGGPAIDALVQRLSSETL
FT                   DDLGGFRDEHLGLPPELKRDLQGPIVA"
     MLPERIPIPE SLHSIETGDP IATCLACDAP LLDGPTEYLV EKGYRQYEAY DVQETVFEYA        60
     ICMDCHAEMR QSFSEPSKRR CQAYLSEHVD LAARTGRLLD ADSRDPADWT RQCVVHGTPR       120
     DELEEYQVIA HCQGDELLLT HLPLLMGGPA IDALVQRLSS ETLDDLGGFR DEHLGLPPEL       180
     KRDLQGPIVA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page