(data stored in ACNUC30630 zone)

EMBL: FP565814.PE67

FP565814.PE67        Location/Qualifiers
FT   CDS             70772..70918
FT                   /transl_table=11
FT                   /locus_tag="SRM_00067"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00067"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22988"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N3"
FT                   /protein_id="CBH22988.1"
FT                   /translation="MTTATEHLRDAFRRSVRYAGGGADPSSGSGGGGGSGGGGSEEDEE
FT                   LET"
     MTTATEHLRD AFRRSVRYAG GGADPSSGSG GGGGSGGGGS EEDEELET                     48
//

If you have problems or comments...

PBIL Back to PBIL home page