(data stored in ACNUC30630 zone)

EMBL: FP565814.PE670

FP565814.PE670       Location/Qualifiers
FT   CDS             816393..816488
FT                   /transl_table=11
FT                   /locus_tag="SRM_00670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23591"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D6"
FT                   /protein_id="CBH23591.1"
FT                   /translation="MRQAIRQAESSFSGLWRRFTGRVYAQSWHGP"
     MRQAIRQAES SFSGLWRRFT GRVYAQSWHG P                                       31
//

If you have problems or comments...

PBIL Back to PBIL home page