(data stored in ACNUC30630 zone)

EMBL: FP565814.PE7

FP565814.PE7         Location/Qualifiers
FT   CDS             complement(6363..7286)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00007"
FT                   /product="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00007"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22928"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H3"
FT                   /protein_id="CBH22928.1"
FT                   /translation="MENPRSDLKDMSGTVCVVTGANSGIGKATAAELARLGARVVMVCR
FT                   DEGRGREAQAELRAEARTAHPSRADTIDLRIADLSVQEEVYHLGETLRADYDRLDVLVN
FT                   NAGVFLESREETVDGVEATFAVNHLAPFLLTHLVLPRLRETAGRAGEARIVTLSSEAHR
FT                   GVSMDFDDLNAETGYNPLQAYAQSKLANILFTHELSRRLQDEGVVANVVHPGIVNTNIW
FT                   RGSGWISRIARLFSWLYKRPEEGARNVVYLAASPDVEGVTGQYFKETEVVNPSPEAYDE
FT                   KAEARLWRISREMTGLAEVDEDGAPE"
     MENPRSDLKD MSGTVCVVTG ANSGIGKATA AELARLGARV VMVCRDEGRG REAQAELRAE        60
     ARTAHPSRAD TIDLRIADLS VQEEVYHLGE TLRADYDRLD VLVNNAGVFL ESREETVDGV       120
     EATFAVNHLA PFLLTHLVLP RLRETAGRAG EARIVTLSSE AHRGVSMDFD DLNAETGYNP       180
     LQAYAQSKLA NILFTHELSR RLQDEGVVAN VVHPGIVNTN IWRGSGWISR IARLFSWLYK       240
     RPEEGARNVV YLAASPDVEG VTGQYFKETE VVNPSPEAYD EKAEARLWRI SREMTGLAEV       300
     DEDGAPE                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page