(data stored in ACNUC30630 zone)

EMBL: FP565814.PHNP

FP565814.PHNP        Location/Qualifiers
FT   CDS             706062..706925
FT                   /transl_table=11
FT                   /gene="phnP"
FT                   /locus_tag="SRM_00572"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00572"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23493"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5H638"
FT                   /protein_id="CBH23493.1"
FT                   /translation="MTTSPHVSTDVPPADRHARTPPVTATLLGTGTSTGVPVIGCDCEV
FT                   CTSADPRDTRTRCACYVEVGDMGLLIDTGPDFRAQALREDIDRIDAVCYTHHHFDHVVG
FT                   LDDLRPYFRDNRRVMPCYAHAETAAVLRRNYDYVFGGDPYPGAANVELEVVDGPFRVPS
FT                   RTADDTAVPVDPILLMHGDVPVYGYRLGRFAYLTDASAIPEASYEQLQGIDTLVLDGLR
FT                   PRPHPTHFSFDEAVAAARRIGARETYLVHMTHDVRHAEAEAALPDDIHLAHDGLTLEVP
FT                   AFDPAV"
     MTTSPHVSTD VPPADRHART PPVTATLLGT GTSTGVPVIG CDCEVCTSAD PRDTRTRCAC        60
     YVEVGDMGLL IDTGPDFRAQ ALREDIDRID AVCYTHHHFD HVVGLDDLRP YFRDNRRVMP       120
     CYAHAETAAV LRRNYDYVFG GDPYPGAANV ELEVVDGPFR VPSRTADDTA VPVDPILLMH       180
     GDVPVYGYRL GRFAYLTDAS AIPEASYEQL QGIDTLVLDG LRPRPHPTHF SFDEAVAAAR       240
     RIGARETYLV HMTHDVRHAE AEAALPDDIH LAHDGLTLEV PAFDPAV                     287
//

If you have problems or comments...

PBIL Back to PBIL home page