(data stored in ACNUC30630 zone)

EMBL: FP565814.PNCB

FP565814.PNCB        Location/Qualifiers
FT   CDS             complement(511280..512668)
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="SRM_00427"
FT                   /product="Nicotinic acid phosphoribosyltransferase"
FT                   /function="The first enzyme in the salvage pathway of NAD
FT                   biosynthesis from nicontinate"
FT                   /EC_number="2.4.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00427"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23348"
FT                   /db_xref="GOA:D5H5P3"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P3"
FT                   /protein_id="CBH23348.1"
FT                   /translation="MPFDDQLRPDTSALYTDLYQLTMLQAYWREDMDEPAVFDLFVRRL
FT                   KDRHYLVACGLEQALEFLETLSFSEAALDYLATQDPFEPAFLDWLADFEFTGDVYAVPE
FT                   GTPVFPDEPLVEVVAPIGEAQLAETFLLNQITFQTTIASKASRIVEAAQLDGEDRIVAD
FT                   FGMRRTHGTDAAVKGARAAHVAGIDSTSNVAAGQAYDLPVTGTMAHSYVEAHDSEVEAF
FT                   RAFSALYPETILLVDTYDTLDGVRKVIDLMNETGDEVQVRGIRLDSGDLAELARSSRTL
FT                   LDEAGLADVMIFASGGLDEHTIADLLDRGAPIDGFGVGTRMGTSADQPALDTAYKLSGY
FT                   AGTPRMKLAPEKSNLPGRKQVVRQYEDGTAVRDVIATEDEQTNGAPLLERVMADGKRTE
FT                   AGAPRPLSAIREHAAARLDELPSRLRAPTANPEDYDVVLSDALETRVADTRDALAETMA
FT                   AEAA"
     MPFDDQLRPD TSALYTDLYQ LTMLQAYWRE DMDEPAVFDL FVRRLKDRHY LVACGLEQAL        60
     EFLETLSFSE AALDYLATQD PFEPAFLDWL ADFEFTGDVY AVPEGTPVFP DEPLVEVVAP       120
     IGEAQLAETF LLNQITFQTT IASKASRIVE AAQLDGEDRI VADFGMRRTH GTDAAVKGAR       180
     AAHVAGIDST SNVAAGQAYD LPVTGTMAHS YVEAHDSEVE AFRAFSALYP ETILLVDTYD       240
     TLDGVRKVID LMNETGDEVQ VRGIRLDSGD LAELARSSRT LLDEAGLADV MIFASGGLDE       300
     HTIADLLDRG APIDGFGVGT RMGTSADQPA LDTAYKLSGY AGTPRMKLAP EKSNLPGRKQ       360
     VVRQYEDGTA VRDVIATEDE QTNGAPLLER VMADGKRTEA GAPRPLSAIR EHAAARLDEL       420
     PSRLRAPTAN PEDYDVVLSD ALETRVADTR DALAETMAAE AA                          462
//

If you have problems or comments...

PBIL Back to PBIL home page