(data stored in ACNUC30630 zone)

EMBL: FP565814.SEPC

FP565814.SEPC        Location/Qualifiers
FT   CDS             complement(685124..686614)
FT                   /transl_table=11
FT                   /gene="sepC"
FT                   /locus_tag="SRM_00556"
FT                   /product="efflux pump outer membrane protein"
FT                   /function="# Probable outer membrane component of the
FT                   sepABC efflux pump with unknown specificity."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00556"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23477"
FT                   /db_xref="GOA:D5H622"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D5H622"
FT                   /protein_id="CBH23477.1"
FT                   /translation="MIGSRLLIASFLLGMLTVAGCSMTPEMSTPEAEQDLPDRFEAAPG
FT                   DTTLPAAAADTAAYDATRWWAAYEDPSLTALVDTALAANLNLEEAQGRVEELAAQFRIA
FT                   RAPLFPSVTANGQGNYQNQPANTGIGGAIGGGQGPDRFEFTDYQATLGLSYELDFWGRV
FT                   RSQRTAALSQYFATAADLQTARLSVISQTISTYAQIASLRRQVRLGERTVGLLEERVAV
FT                   TEDRYARGLVPSFQLYTVRQSLQAAQADQPDLERRLYEAQSRFATLLGRFAGEQRALLP
FT                   DSMTVPLAPEPVPAGLPADLLMQRPDVRGAALRLEAARQEIGVARAEMLPSLSLTGQGG
FT                   TQSSELADLVDPGQVFASFAGQLTAPLFQGGQLRANLNAAEARYKQQAARYEQTVLTAF
FT                   QEVKASLVAYEKQRQRYREVERQVDTARDAFQAQRDRYERGVGDVLSLIDAERTLLQAR
FT                   TRLAGVRRAVTNARLALHRALGGPWTDAEPVDDPRLFR"
     MIGSRLLIAS FLLGMLTVAG CSMTPEMSTP EAEQDLPDRF EAAPGDTTLP AAAADTAAYD        60
     ATRWWAAYED PSLTALVDTA LAANLNLEEA QGRVEELAAQ FRIARAPLFP SVTANGQGNY       120
     QNQPANTGIG GAIGGGQGPD RFEFTDYQAT LGLSYELDFW GRVRSQRTAA LSQYFATAAD       180
     LQTARLSVIS QTISTYAQIA SLRRQVRLGE RTVGLLEERV AVTEDRYARG LVPSFQLYTV       240
     RQSLQAAQAD QPDLERRLYE AQSRFATLLG RFAGEQRALL PDSMTVPLAP EPVPAGLPAD       300
     LLMQRPDVRG AALRLEAARQ EIGVARAEML PSLSLTGQGG TQSSELADLV DPGQVFASFA       360
     GQLTAPLFQG GQLRANLNAA EARYKQQAAR YEQTVLTAFQ EVKASLVAYE KQRQRYREVE       420
     RQVDTARDAF QAQRDRYERG VGDVLSLIDA ERTLLQARTR LAGVRRAVTN ARLALHRALG       480
     GPWTDAEPVD DPRLFR                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page