(data stored in ACNUC30630 zone)

EMBL: FP565814.SPSF

FP565814.SPSF        Location/Qualifiers
FT   CDS             846417..847223
FT                   /transl_table=11
FT                   /gene="spsF"
FT                   /locus_tag="SRM_00697"
FT                   /product="Spore coat polysaccharide biosynthesis protein
FT                   spsF"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00697"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23618"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G3"
FT                   /protein_id="CBH23618.1"
FT                   /translation="MDRVCACIIARLNSTRLSRKVLADIKGKPLLKWIVDRLNAVDNVD
FT                   EVVLCTSSDPGDEELLEHADDWGIPAIAGSPTNIVSRLQQAASTVDADILLRATGDNPL
FT                   ISVEYTERMVAAHKKSDFEYSRVNSLPLGATVEGLSKGLLPKIQETLPSPSHSEYLVLY
FT                   AYQPERYNCVVLQPPDEIQRPHYSVTVDTPDDLERAREIYGETAWRSDIGPSIDQVIQF
FT                   LDEDENYEEIPGDTMIKMPEQGRIPYNDFLDLLKDRAVESTTITFN"
     MDRVCACIIA RLNSTRLSRK VLADIKGKPL LKWIVDRLNA VDNVDEVVLC TSSDPGDEEL        60
     LEHADDWGIP AIAGSPTNIV SRLQQAASTV DADILLRATG DNPLISVEYT ERMVAAHKKS       120
     DFEYSRVNSL PLGATVEGLS KGLLPKIQET LPSPSHSEYL VLYAYQPERY NCVVLQPPDE       180
     IQRPHYSVTV DTPDDLERAR EIYGETAWRS DIGPSIDQVI QFLDEDENYE EIPGDTMIKM       240
     PEQGRIPYND FLDLLKDRAV ESTTITFN                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page