(data stored in ACNUC16935 zone)

EMBL: HQ318095.RPL40

HQ318095.RPL40       Location/Qualifiers
FT   CDS             15..401
FT                   /codon_start=1
FT                   /gene="Rpl40"
FT                   /product="ribosomal protein L40"
FT                   /db_xref="GOA:D2GV37"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:D2GV37"
FT                   /protein_id="AEA39530.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
     MQIFVKTLTG KTITLEVEPS DTIENVKAKI QDKEGIPPDQ QRLIFAGKQL EDGRTLSDYN        60
     IQKESTLHLV LRLRGGIIEP SLRQLAQKYN CDKMICRKCY ARLHPRAVNC RKKKCGHTNN       120
     LRPKKKVK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page