(data stored in SCRATCH zone)

EMBL: KY906033

KY906033             Location/Qualifiers
FT   CDS             1..>1221
FT                   /codon_start=1
FT                   /gene="AT5G01250.1"
FT                   /product="alpha 1,4-glycosyltransferase family protein"
FT                   /db_xref="GOA:Q9LFB1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB1"
FT                   /protein_id="ARJ31397.1"
FT                   /translation="MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFT
FT                   LISNFSMQPHRDFSGVKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSG
FT                   DNLSDKFQKRVNEFVGDGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSA
FT                   TMDSPQGYATLKPFIDRGYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQN
FT                   LSNLMRLAYLYKYGGVYLDTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDK
FT                   NHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLE
FT                   IKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCII
FT                   CEISSVSS"
     MDRHDIEKRF TVVIDNRRLN QSGSSSLFTA FAISFVTLIV VTTFTLISNF SMQPHRDFSG        60
     VKIEIKRVIP HLPLSSEREG ERSDLLKQQT QVNEKLQVIE VFSGDNLSDK FQKRVNEFVG       120
     DGCEVNFVMT WISPADFFGN REVLAIESVF KSHPYGCLMI LSATMDSPQG YATLKPFIDR       180
     GYKVLAVTPD LPFLLKGTAG ELWLDEIKSG KRDPGKISLA QNLSNLMRLA YLYKYGGVYL       240
     DTDMIVLKSF KGLRNVIGAQ TLDPSSTNWT RLNNAVLIFD KNHPLLLKFM EEFAKTFNGN       300
     IWGYNGPYLV SRVARAVEGS SGYNFTVMRP SVFYSVNWLE IKKLFKVPKT EKDSKWVKTK       360
     LLHMQRNGYG LHLWNKFSRK YEIEQGSAMW KLVSEHCIIC EISSVSS                     407
//

If you have problems or comments...

PBIL Back to PBIL home page